You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePhenylalanyl-tRNA synthetase beta chain
Synonyms
  • Phenylalanine--tRNA ligase beta chain
  • PheRS
Gene NameFRS1
Enzyme Class
Biological Properties
General FunctionInvolved in RNA binding
Specific FunctionATP + L-phenylalanine + tRNA(Phe) = AMP + diphosphate + L-phenylalanyl-tRNA(Phe)
Cellular LocationCytoplasm
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00097Adenosine monophosphateShow
YMDB00109Adenosine triphosphateShow
YMDB00219PyrophosphateShow
YMDB00304L-PhenylalanineShow
GO Classification
Component
cell part
intracellular part
cytoplasm
Function
ATP binding
ligase activity, forming carbon-oxygen bonds
ligase activity
ligase activity, forming aminoacyl-tRNA and related compounds
aminoacyl-tRNA ligase activity
ion binding
binding
nucleotide binding
cation binding
metal ion binding
magnesium ion binding
nucleoside binding
nucleic acid binding
purine nucleoside binding
RNA binding
catalytic activity
adenyl nucleotide binding
phenylalanine-tRNA ligase activity
adenyl ribonucleotide binding
Process
macromolecule metabolic process
phenylalanyl-tRNA aminoacylation
macromolecule biosynthetic process
cellular macromolecule biosynthetic process
translation
biosynthetic process
cellular macromolecule metabolic process
RNA metabolic process
ncRNA metabolic process
tRNA metabolic process
tRNA aminoacylation
metabolic process
tRNA aminoacylation for protein translation
Gene Properties
Chromosome Locationchromosome 12
LocusYLR060W
Gene Sequence>1788 bp ATGCCTACCGTCTCCGTGAACAAGCAGCAATTATTTGATCTTCTAGGCAAAAACTACACT TCCCAAGAGTTCGATGAATTATGTTTTGAATTCGGTATGGAAATGGACGAAGACACCACA GAGGAGGCCTTGAAAACCGGGGAGGAGCCGGAATTGAAGCTTGATATCAGTGCCAATCGT TACGATTTGCTTTGTATCGAAGGTATTTCACAGTCGCTGAACGAATACTTGGAACGTAAA GAAAGACCTGACTATAAATTAAGCAAGCCAACCACTAAGTTGATCATCGACAAATCAACG GAGCAAATTAGACCTTTTGCTACCGCTGCTGTATTGAGAAATATCAAGCTTAACGAAAAA TCTTACGCTTCTTTTATTGCCTTGCAAGATAAATTACATGCCAATCTATGTAGAAACAGA AGCTTGGTTGCCATGGGTACTCACGATTTAGATTCAATTGAAGGTCCATTCCATTACAGA GCTCTACCACCAAAGGACATCAAGTTCGTACCATTGAATCAAACCCAAGAGTTTACTGGT GACAAATTGATCGAGTTTTATAAATCTCCAGAACAGAAAAACAACATAGGGAGATACGTT CACATTATTGAGGATTCTCCAGTCTTCCCAGTTATTATGGACAGCAAAGATCGTGTTTGC TCCCTGCCACCATTAATCAATAGTGAACATTCGAAGATCTCTGTGAACACCCGTAACATT TTGATTGATATAACCGCCACCGATAAGACCAAAGCCGAGATCGTTTTGAACATATTAACT ACAATGTTCTCACGTTATTGTGACGAACCATTCACGGTTGAGCCTGTAGAAATTGTCTCT GAACACAATGGCCAATCCCGTTTGGCGCCAAACTTCAACGATAGAATTATGGATGTCTCC ATTAAGTACATCAACTCCTGTCTTGGCCTAGATCAATCCGCTGATGAAATTGCTCATTGT CTAAAGAAGATGTCGTTGCATGCCGTTCAATCAAAGGAAGACAAGGACATCTTGCACGTT GACATTCCGGTAACTAGACCTGATATTTTGCACGCTTGTGATATAATGGAAGATGCCGCT GTCGGTTATGGTTTCAATAATTTGCCAAAGGGTGAGAAATTATCCAATGCCAACTTCATT GCCAAACCATTACCAATCAACAAGGTTTCTGATATTTTCAGAGTTGCATCCTCTCAAGCC ACGTGGGTTGAGGTTTTACCATTGACCTTATGTTCGCACGATGAAAACTTTAAATTTCTA AGACAATCCGACAATGGTGATTTAGCTGTCAAATTGGCCAACCCAAAGACTTTGGAATAC CAAGTTGTTAGAACCACTTTATTGCCTGGTATCTTAAAGACAGTCAAGGAAAACAGAAAA CATTCCTTGCCAATCAAAGTCTTTGAAACCGGTGACGTTGTATTTAAAGACGACAAACTA GAAAGGAAGGCGTACAATGAACGTCACTGGGCTGCCATCTACGTGGGTAAGAATTCTGGG TTTGAAATCATTCAAGGGTTATTGGGTAAAATCATGCAAACTTTTAGAACAGAGTGGATT GCAGACTACGGTGCTGCTGCTTCTGGCAGAGGTTACTGGATTGAAGAAGACGATTCTGTG AAAACCTACTTCCCAGGTAGAGGTGCCAAGGTCATGTTCAGATCCAAAGAAGGCGCTGAG CCAAAGCAAATCGGCCACTTGGGTGTCTTGCATCCTGAAGTCATGATGAATTTCGACGTT CCATTCGCTGCATCCTTTGTAGAGGTTAATGCCGAAGTCTTCCTATAA
Protein Properties
Pfam Domain Function
Protein Residues595
Protein Molecular Weight67364.29688
Protein Theoretical pI5.55
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Phenylalanyl-tRNA synthetase beta chain MPTVSVNKQQLFDLLGKNYTSQEFDELCFEFGMEMDEDTTEEALKTGEEPELKLDISANR YDLLCIEGISQSLNEYLERKERPDYKLSKPTTKLIIDKSTEQIRPFATAAVLRNIKLNEK SYASFIALQDKLHANLCRNRSLVAMGTHDLDSIEGPFHYRALPPKDIKFVPLNQTQEFTG DKLIEFYKSPEQKNNIGRYVHIIEDSPVFPVIMDSKDRVCSLPPLINSEHSKISVNTRNI LIDITATDKTKAEIVLNILTTMFSRYCDEPFTVEPVEIVSEHNGQSRLAPNFNDRIMDVS IKYINSCLGLDQSADEIAHCLKKMSLHAVQSKEDKDILHVDIPVTRPDILHACDIMEDAA VGYGFNNLPKGEKLSNANFIAKPLPINKVSDIFRVASSQATWVEVLPLTLCSHDENFKFL RQSDNGDLAVKLANPKTLEYQVVRTTLLPGILKTVKENRKHSLPIKVFETGDVVFKDDKL ERKAYNERHWAAIYVGKNSGFEIIQGLLGKIMQTFRTEWIADYGAAASGRGYWIEEDDSV KTYFPGRGAKVMFRSKEGAEPKQIGHLGVLHPEVMMNFDVPFAASFVEVNAEVFL
References
External Links
ResourceLink
Saccharomyces Genome Database FRS1
Uniprot IDP15624
Uniprot NameSYFB_YEAST
GenBank Gene IDX94607
Genebank Protein ID1181281
General Reference
  • Sanni, A., Mirande, M., Ebel, J. P., Boulanger, Y., Waller, J. P., Fasiolo, F. (1988). "Structure and expression of the genes encoding the alpha and beta subunits of yeast phenylalanyl-tRNA synthetase." J Biol Chem 263:15407-15415.3049607
  • Johnston, M., Hillier, L., Riles, L., Albermann, K., Andre, B., Ansorge, W., Benes, V., Bruckner, M., Delius, H., Dubois, E., Dusterhoft, A., Entian, K. D., Floeth, M., Goffeau, A., Hebling, U., Heumann, K., Heuss-Neitzel, D., Hilbert, H., Hilger, F., Kleine, K., Kotter, P., Louis, E. J., Messenguy, F., Mewes, H. W., Hoheisel, J. D., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XII." Nature 387:87-90.9169871
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956