You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameN(2),N(2)-dimethylguanosine tRNA methyltransferase, mitochondrial
Synonyms
  • tRNA 2,2-dimethylguanosine-26 methyltransferase
  • tRNA(guanine-26,N(2)-N(2)) methyltransferase
  • tRNA(m(2,2)G26)dimethyltransferase
Gene NameTRM1
Enzyme Class
Biological Properties
General FunctionInvolved in RNA binding
Specific FunctionDimethylates a single guanine residue at position 26 of most tRNAs using S-adenosyl-L-methionine as donor of the methyl groups. Required for the modification of both mitochondrial and cytoplasmic tRNAs
Cellular LocationMitochondrion. Nucleus. Cytoplasm.
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00198S-AdenosylhomocysteineShow
YMDB00297S-AdenosylmethionineShow
GO Classification
Component
Not Available
Function
transferase activity, transferring one-carbon groups
methyltransferase activity
binding
nucleic acid binding
RNA binding
N-methyltransferase activity
catalytic activity
tRNA (guanine-N2-)-methyltransferase activity
transferase activity
Process
metabolic process
macromolecule metabolic process
cellular macromolecule metabolic process
RNA metabolic process
ncRNA metabolic process
tRNA metabolic process
tRNA processing
Gene Properties
Chromosome Locationchromosome 4
LocusYDR120C
Gene Sequence>1713 bp ATGGAAGGTTTCTTCAGGATACCCCTCAAGCGGGCAAATTTACACGGAATGTTGAAGGCT GCTATATCCAAAATTAAAGCGAATTTTACCGCGTATGGTGCACCAAGAATCAATATTGAG GATTTCAATATAGTCAAGGAAGGAAAAGCAGAAATTCTTTTCCCTAAAAAGGAAACTGTT TTCTATAATCCCATCCAACAATTTAATAGAGATCTAAGTGTTACATGCATCAAGGCGTGG GACAACCTATATGGTGAGGAATGTGGCCAAAAGAGAAATAATAAAAAAAGTAAGAAGAAA AGGTGCGCGGAAACTAACGATGATTCTTCCAAGCGTCAAAAAATGGGAAACGGGTCACCA AAAGAAGCCGTTGGTAATTCTAATCGAAACGAACCTTATATAAATATTTTGGAAGCATTG TCAGCCACTGGGTTAAGAGCCATTAGGTATGCTCATGAAATTCCCCATGTGAGGGAAGTT ATTGCTAACGATTTACTTCCAGAGGCTGTCGAATCTATAAAACGAAACGTTGAATATAAT AGTGTCGAAAACATTGTCAAGCCAAACCTTGATGATGCTAATGTCTTAATGTACCGTAAC AAAGCGACGAATAATAAGTTTCACGTCATCGACTTGGATCCTTACGGTACCGTTACACCT TTTGTAGATGCGGCTATTCAGAGTATTGAGGAGGGTGGTCTAATGCTGGTAACTTGCACT GATTTATCCGTTTTGGCCGGTAACGGATACCCAGAAAAGTGTTTTGCCTTATATGGTGGT GCAAATATGGTTTCTCATGAATCAACTCACGAAAGTGCGCTGAGACTAGTATTGAACTTA CTAAAGCAAACTGCCGCGAAATACAAGAAAACTGTGGAACCGCTTTTGTCGTTGAGCATT GACTTTTACGTCAGAGTTTTTGTCAAAGTCAAAACAAGCCCGATTGAAGTCAAAAACGTT ATGTCAAGTACTATGACTACTTACCATTGTTCCCGTTGCGGCTCTTACCACAATCAACCT CTGGGCAGAATTTCTCAACGCGAAGGTAGGAACAACAAAACATTCACCAAATACTCGGTT GCGCAAGGGCCTCCGGTTGATACTAAATGTAAGTTCTGCGAGGGGACATACCATTTAGCT GGTCCAATGTATGCAGGACCTCTACACAACAAGGAGTTCATCGAGGAGGTGTTGAGAATT AATAAAGAAGAGCATCGTGACCAGGATGATACATATGGAACACGTAAAAGAATTGAAGGT ATGCTATCTCTAGCTAAGAATGAATTATCCGATTCGCCATTCTATTTCAGTCCTAACCAT ATTGCATCGGTAATAAAATTACAAGTACCTCCCTTGAAAAAAGTAGTCGCAGGCCTAGGT TCCCTAGGCTTTGAATGTTCATTGACACATGCCCAACCATCGTCCCTAAAGACTAACGCT CCATGGGATGCAATCTGGTATGTGATGCAGAAATGTGATGATGAGAAGAAAGACTTAAGC AAAATGAATCCAAATACTACGGGCTATAAGATTTTATCGGCAATGCCAGGATGGTTGAGT GGCACTGTCAAATCAGAGTATGACTCAAAGCTGTCGTTCGCACCAAATGAACAAAGCGGT AATATTGAAAAACTAAGGAAGCTAAAAATTGTGAGATATCAGGAAAATCCAACAAAGAAT TGGGGCCCAAAAGCCCGTCCCAACACTTCATAA
Protein Properties
Pfam Domain Function
Protein Residues570
Protein Molecular Weight64051.80078
Protein Theoretical pI9.49
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>N(2),N(2)-dimethylguanosine tRNA methyltransferase, mitochondrial MEGFFRIPLKRANLHGMLKAAISKIKANFTAYGAPRINIEDFNIVKEGKAEILFPKKETV FYNPIQQFNRDLSVTCIKAWDNLYGEECGQKRNNKKSKKKRCAETNDDSSKRQKMGNGSP KEAVGNSNRNEPYINILEALSATGLRAIRYAHEIPHVREVIANDLLPEAVESIKRNVEYN SVENIVKPNLDDANVLMYRNKATNNKFHVIDLDPYGTVTPFVDAAIQSIEEGGLMLVTCT DLSVLAGNGYPEKCFALYGGANMVSHESTHESALRLVLNLLKQTAAKYKKTVEPLLSLSI DFYVRVFVKVKTSPIEVKNVMSSTMTTYHCSRCGSYHNQPLGRISQREGRNNKTFTKYSV AQGPPVDTKCKFCEGTYHLAGPMYAGPLHNKEFIEEVLRINKEEHRDQDDTYGTRKRIEG MLSLAKNELSDSPFYFSPNHIASVIKLQVPPLKKVVAGLGSLGFECSLTHAQPSSLKTNA PWDAIWYVMQKCDDEKKDLSKMNPNTTGYKILSAMPGWLSGTVKSEYDSKLSFAPNEQSG NIEKLRKLKIVRYQENPTKNWGPKARPNTS
References
External Links
ResourceLink
Saccharomyces Genome Database TRM1
Uniprot IDP15565
Uniprot NameTRM1_YEAST
GenBank Gene IDM17193
Genebank Protein ID172940
General Reference
  • Ellis, S. R., Hopper, A. K., Martin, N. C. (1987). "Amino-terminal extension generated from an upstream AUG codon is not required for mitochondrial import of yeast N2,N2-dimethylguanosine-specific tRNA methyltransferase." Proc Natl Acad Sci U S A 84:5172-5176.3299379
  • Liu, J., Liu, J., Straby, K. B. (1998). "Point and deletion mutations eliminate one or both methyl group transfers catalysed by the yeast TRM1 encoded tRNA (m22G26)dimethyltransferase." Nucleic Acids Res 26:5102-5108.9801306
  • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867
  • Liu, J., Zhou, G. Q., Straby, K. B. (1999). "Caenorhabditis elegans ZC376.5 encodes a tRNA (m2/2G(26))dimethyltransferance in which (246)arginine is important for the enzyme activity." Gene 226:73-81.10048958
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106