You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameProline-specific permease
SynonymsNot Available
Gene NamePUT4
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in transport
Specific FunctionRequired for high-affinity proline transport. May be responsible for proline recognition and probably also for proline translocation across the plasma membrane. Also function as non- specific GABA permease. Can also transport alanine and glycine
Cellular LocationMembrane; Multi-pass membrane protein
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00016GlycineShow
YMDB00154L-AlanineShow
YMDB00335gamma-Aminobutyric acidShow
YMDB00378L-ProlineShow
YMDB00862hydronShow
GO Classification
Component
cell part
membrane
membrane part
intrinsic to membrane
integral to membrane
Function
amino acid transmembrane transporter activity
transporter activity
transmembrane transporter activity
active transmembrane transporter activity
amine transmembrane transporter activity
Process
amine transport
amino acid transport
transmembrane transport
establishment of localization
transport
Gene Properties
Chromosome Locationchromosome 15
LocusYOR348C
Gene Sequence>1884 bp ATGGTAAATATACTGCCCTTCCACAAGAACAATAGACACAGCGCGGGAGTCGTCACCTGC GCGGACGATGTTAGCGGCGACGGTAGCGGCGGCGACACCAAGAAGGAGGAGAATGTTGTC CAGGTAACGGAATCACCATCGTCCGGGTCGCGCAATAATCATCGCAGCGACAATGAAAAA GATGACGCCATCCGTATGGAGAAAATATCTAAGAACCAGTCCGCGTCGTCCAACGGCACC ATCCGCGAGGATTTGATTATGGACGTGGACTTGGAGAAATCGCCCTCCGTCGATGGCGAT AGCGAGCCGCACAAACTAAAACAAGGTTTGCAGTCGCGCCATGTGCAACTGATCGCGCTG GGCGGCGCCATCGGTACCGGTTTGCTGGTGGGGACTTCATCCACGCTTCATACGTGCGGT CCCGCGGGGCTGTTCATATCGTACATTATTATTTCCGCGGTGATCTACCCGATCATGTGC GCGCTGGGCGAAATGGTGTGCTTTTTGCCCGGTGATGGTTCTGACAGTGCCGGGTCGACG GCCAATCTGGTCACTAGGTACGTTGACCCTTCGTTGGGCTTCGCCACTGGGTGGAATTAC TTCTACTGCTACGTCATTTTAGTGGCCGCCGAGTGTACGGCGGCATCCGGTGTGGTCGAA TACTGGACCACCGCGGTTCCCAAGGGCGTTTGGATCACGATCTTTCTATGCGTGGTTGTT ATACTAAACTTTTCCGCGGTCAAAGTGTACGGCGAATCCGAGTTTTGGTTCGCGTCTATC AAGATATTATGCATTGTGGGACTGATCATTCTGTCCTTTATTTTGTTTTGGGGTGGTGGC CCCAACCATGACCGTCTTGGCTTCAGATACTGGCAACATCCGGGCGCTTTTGCGCATCAC CTCACGGGCGGATCGCTGGGTAACTTCACAGATATCTACACTGGGATTATCAAGGGCGCC TTCGCCTTCATTCTTGGTCCGGAACTGGTGTGCATGACTTCCGCGGAATGCGCGGACCAG CGTAGAAATATCGCTAAGGCTTCGCGCCGCTTTGTATGGAGACTGATCTTCTTCTACGTT CTGGGGACGCTGGCCATCTCCGTTATTGTTCCATATAATGACCCAACATTGGTAAATGCG CTGGCGCAGGGCAAACCGGGAGCCGGCTCGTCACCCTTTGTGATCGGAATTCAAAACGCC GGGATTAAGGTTCTTCCCCACATTATCAATGGGTGTATCTTGACCAGCGCGTGGTCTGCC GCCAATGCGTTTATGTTTGCGAGCACAAGATCCCTGTTGACCATGGCGCAAACGGGACAG GCACCCAAATGTTTGGGCAGAATCAACAAATGGGGTGTTCCATACGTGGCTGTGGGTGTT TCCTTCTTGTGTTCTTGTTTGGCATATCTGAACGTGTCTTCATCCACGGCAGACGTGTTC AATTGGTTTTCCAATATCAGCACCATTTCCGGGTTTCTGGGCTGGATGTGCGGCTGCATC GCGTACCTGAGATTCCGCAAGGCTATTTTCTACAATGGCCTCTACGACAGATTGCCTTTC AAGACGTGGGGACAGCCTTACACCGTGTGGTTCTCTCTCATTGTTATAGGCATCATCACC ATTACCAACGGGTATGCCATTTTCATCCCTAAGTACTGGAGAGTAGCAGATTTCATAGCT GCCTACATCACCCTACCCATCTTCCTGGTTTTGTGGTTCGGCCATAAGCTGTATACTCGG ACGTGGAGACAATGGTGGCTCCCTGTGTCCGAGATCGATGTTACTACAGGGCTAGTCGAG ATCGAAGAGAAATCAAGAGAAATTGAGGAGATGAGATTACCCCCCACCGGTTTCAAAGAC AAGTTCTTGGACGCCTTGTTGTAA
Protein Properties
Pfam Domain Function
Protein Residues627
Protein Molecular Weight68786.79688
Protein Theoretical pI7.59
Signalling Regions
  • None
Transmembrane Regions
  • 115-136
  • 142-162
  • 191-210
  • 229-247
  • 262-281
  • 306-326
  • 351-370
  • 408-427
  • 455-473
  • 483-503
  • 522-542
  • 558-578
Protein Sequence>Proline-specific permease MVNILPFHKNNRHSAGVVTCADDVSGDGSGGDTKKEEDVVQVTESPSSGSRNNHRSDNEK DDAIRMEKISKNQSASSNGTIREDLIMDVDLEKSPSVDGDSEPHKLKQGLQSRHVQLIAL GGAIGTGLLVGTSSTLHTCGPAGLFISYIIISAVIYPIMCALGEMVCFLPGDGSDSAGST ANLVTRYVDPSLGFATGWNYFYCYVILVAAECTAASGVVEYWTTAVPKGVWITIFLCVVV ILNFSAVKVYGESEFWFASIKILCIVGLIILSFILFWGGGPNHDRLGFRYWQHPGAFAHH LTGGSLGNFTDIYTGIIKGAFAFILGPELVCMTSAECADQRRNIAKASRRFVWRLIFFYV LGTLAISVIVPYNDPTLVNALAQGKPGAGSSPFVIGIQNAGIKVLPHIINGCILTSAWSA ANAFMFASTRSLLTMAQTGQAPKCLGRINKWGVPYVAVGVSFLCSCLAYLNVSSSTADVF NWFSNISTISGFLGWMCGCIAYLRFRKAIFYNGLYDRLPFKTWGQPYTVWFSLIVIGIIT ITNGYAIFIPKYWRVADFIAAYITLPIFLVLWFGHKLYTRTWRQWWLPVSEIDVTTGLVE IEEKSREIEEMRLPPTGFKDKFLDALL
References
External Links
ResourceLink
Saccharomyces Genome Database PUT4
Uniprot IDP15380
Uniprot NamePUT4_YEAST
GenBank Gene IDM30583
Genebank Protein ID172307
General Reference
  • Vandenbol, M., Jauniaux, J. C., Grenson, M. (1989). "Nucleotide sequence of the Saccharomyces cerevisiae PUT4 proline-permease-encoding gene: similarities between CAN1, HIP1 and PUT4 permeases." Gene 83:153-159.2687114
  • Purnelle, B., Goffeau, A. (1996). "Nucleotide sequence analysis of a 40 kb segment on the right arm of yeast chromosome XV reveals 18 open reading frames including a new pyruvate kinase and three homologues to chromosome I genes." Yeast 12:1475-1481.8948102
  • Dujon, B., Albermann, K., Aldea, M., Alexandraki, D., Ansorge, W., Arino, J., Benes, V., Bohn, C., Bolotin-Fukuhara, M., Bordonne, R., Boyer, J., Camasses, A., Casamayor, A., Casas, C., Cheret, G., Cziepluch, C., Daignan-Fornier, B., Dang, D. V., de Haan, M., Delius, H., Durand, P., Fairhead, C., Feldmann, H., Gaillon, L., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XV." Nature 387:98-102.9169874
  • Regenberg, B., During-Olsen, L., Kielland-Brandt, M. C., Holmberg, S. (1999). "Substrate specificity and gene expression of the amino-acid permeases in Saccharomyces cerevisiae." Curr Genet 36:317-328.10654085