You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameAMP deaminase
Synonyms
  • Myoadenylate deaminase
Gene NameAMD1
Enzyme Class
Biological Properties
General FunctionInvolved in deaminase activity
Specific FunctionAMP deaminase plays a critical role in energy metabolism
Cellular LocationCytoplasmic
SMPDB PathwaysNot Available
KEGG Pathways
Purine metabolismec00230 Map00230
SMPDB ReactionsNot Available
KEGG Reactions
Adenosine monophosphate + water + hydronInosinic acid + Ammonium
Metabolites
YMDB IDNameView
YMDB00091AmmoniaShow
YMDB00097Adenosine monophosphateShow
YMDB00352Inosinic acidShow
YMDB00423AmmoniumShow
YMDB00862hydronShow
YMDB00890waterShow
GO Classification
Component
Not Available
Function
hydrolase activity
hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds
hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in cyclic amidines
deaminase activity
AMP deaminase activity
catalytic activity
Process
nucleoside phosphate metabolic process
nucleotide metabolic process
purine nucleotide metabolic process
purine nucleotide biosynthetic process
purine nucleoside monophosphate biosynthetic process
purine ribonucleoside monophosphate biosynthetic process
metabolic process
nitrogen compound metabolic process
cellular metabolic process
cellular nitrogen compound metabolic process
cellular aromatic compound metabolic process
nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
nucleobase metabolic process
nucleobase, nucleoside and nucleotide metabolic process
purine base metabolic process
Gene Properties
Chromosome Locationchromosome 13
LocusYML035C
Gene Sequence>2433 bp ATGGACAATCAGGCTACACAGAGGCTTAACGACCTTTCTCTAGAACCAGCTCCTTCACAC GATGAACAAGATGGTTCAGGACTAGTCATTGACATAGATCAAAGAAAGATTGGTGATGAA CAAGCTGGTGTCGTAGTGGATGATGAGACACCCCCCTTAGAGCAGCAAGATTCACACGAA AGTTTAGCTGCTGATTCTCGGAATGCTAATTTCTCGTATCACGAGAATCAGCAGTTGTTG GAAAATGGCACCAAACAGTTGGCCCTAGATGAGCATGATTCTCACTCTGCCATCTTGGAG CAACCATCGCATTCTACCAATTGTAGCTCTTCCAACATAGCAGCGATGAATAAGGGCCAT GACTCGGCAGACCATGCATCTCAAAATTCCGGGGGTAAACCGAGGACCTTGTCTGCTAGT GCTCAGCATATCTTGCCAGAGACGCTCAAGTCATTTGCCGGCGCTCCGGTAGTGAATAAG CAGGTACGTACCTCTGCCTCCTATAAAATGGGAATGTTGGCTGATGATGCTTCACAGCAG TTTCTTGATGATCCCTCTTCCGAGTTGATTGACTTGTATTCCAAAGTGGCAGAGTGTAGA AATTTGAGAGCCAAATATCAGACCATATCTGTGCAAAACGATGATCAAAACCCAAAAAAT AAGCCAGGCTGGGTAGTCTATCCACCACCACCTAAACCTTCATACAACTCAGACACTAAG ACTGTTGTGCCAGTAACAAACAAGCCGGATGCGGAAGTTTTCGATTTTACGAAATGTGAA ATTCCTGGTGAGGATCCAGATTGGGAATTTACCCTCAACGATGACGACTCGTACGTGGTA CACAGATCAGGTAAGACGGATGAGTTAATTGCTCAAATCCCTACCCTTCGTGACTACTAT CTGGATCTAGAAAAAATGATTTCCATCTCATCAGACGGTCCCGCTAAATCATTTGCTTAT AGAAGGCTGCAATACCTAGAAGCACGCTGGAATCTTTACTATCTCTTGAACGAATATCAA GAAACTAGCGTTTCCAAAAGAAACCCACACAGGGATTTTTATAATGTTAGGAAAGTGGAC ACTCACGTTCACCATTCTGCTTGTATGAACCAAAAGCACTTATTACGTTTCATTAAACAC AAATTGAGACATTCCAAAGATGAAAAGGTTATTTTCAGGGACGGGAAACTACTAACTTTA GACGAAGTATTCCGTTCTTTGCATTTGACTGGATATGATTTATCCATCGATACTTTAGAT ATGCATGCACATAAGGATACATTCCACAGATTCGATAAATTCAACTTAAAATATAACCCT ATCGGTGAATCTCGTCTCAGAGAAATTTTTTTGAAGACAAACAACTACATCAAGGGTACC TACTTGGCTGACATTACCAAACAAGTCATATTCGATTTAGAGAATTCAAAATACCAAAAC TGTGAGTATAGAATTTCTGTTTATGGCAGGTCTCTCGATGAATGGGATAAACTAGCCAGC TGGGTGATTGACAACAAAGTTATTTCCCATAATGTTCGTTGGTTAGTCCAAATTCCGAGG TTATATGATATTTACAAGAAAACTGGCATTGTTCAAAGCTTCCAGGACATCTGTAAGAAT CTGTTTCAGCCACTATTTGAAGTGACCAAAAATCCTCAGTCTCATCCAAAATTGCATGTA TTTTTACAGAGAGTAATTGGGTGTGATTCTGTCGATGATGAATCCAAGGTTGATCGCCGC TTTCATAGGAAATATCCCAAGCCATCACTCTGGGAGGCTCCTCAAAACCCTCCTTATTCC TATTACCTGTACTATTTGTATTCAAATGTCGCGTCTTTGAATCAATGGAGGGCTAAGAGA GGGTTTAACACTTTGGTTTTGAGACCACATTGTGGTGAAGCCGGTGACCCCGAGCATCTC GTTTCAGCATATCTATTGGCACATGGTATATCACATGGTATTTTATTGAGGAAAGTTCCA TTTGTTCAATACTTATACTATTTAGATCAGGTTGGTATCGCAATGTCACCCCTTTCTAAT AACGCATTATTTTTGACCTATGATAAAAACCCATTTCCGAGATACTTTAAAAGAGGTTTG AATGTCTCACTATCCACAGATGATCCTTTACAATTCTCATATACCAGAGAACCATTAATC GAAGAATACTCAGTTGCAGCACAAATTTATAAATTGTCTAATGTAGATATGTGTGAATTG GCAAGAAATTCCGTGTTGCAAAGTGGGTGGGAAGCACAAATCAAAAAACATTGGATAGGG AAAGATTTTGACAAGAGTGGTGTTGAAGGTAACGATGTGGTTAGAACAAATGTTCCTGAT ATTAGAATTAACTACAGATACGATACATTATCAACTGAATTGGAATTAGTTAATCATTTT GCCAATTTCAAAAGAACCATTGAAGAAAAGTGA
Protein Properties
Pfam Domain Function
Protein Residues810
Protein Molecular Weight93300.79688
Protein Theoretical pI6.59
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>AMP deaminase MDNQATQRLNDLSLEPAPSHDEQDGSGLVIDIDQRKIGDEQAGVVVDDETPPLEQQDSHE SLAADSRNANFSYHENQQLLENGTKQLALDEHDSHSAILEQPSHSTNCSSSNIAAMNKGH DSADHASQNSGGKPRTLSASAQHILPETLKSFAGAPVVNKQVRTSASYKMGMLADDASQQ FLDDPSSELIDLYSKVAECRNLRAKYQTISVQNDDQNPKNKPGWVVYPPPPKPSYNSDTK TVVPVTNKPDAEVFDFTKCEIPGEDPDWEFTLNDDDSYVVHRSGKTDELIAQIPTLRDYY LDLEKMISISSDGPAKSFAYRRLQYLEARWNLYYLLNEYQETSVSKRNPHRDFYNVRKVD THVHHSACMNQKHLLRFIKHKLRHSKDEKVIFRDGKLLTLDEVFRSLHLTGYDLSIDTLD MHAHKDTFHRFDKFNLKYNPIGESRLREIFLKTNNYIKGTYLADITKQVIFDLENSKYQN CEYRISVYGRSLDEWDKLASWVIDNKVISHNVRWLVQIPRLYDIYKKTGIVQSFQDICKN LFQPLFEVTKNPQSHPKLHVFLQRVIGFDSVDDESKVDRRFHRKYPKPSLWEAPQNPPYS YYLYYLYSNVASLNQWRAKRGFNTLVLRPHCGEAGDPEHLVSAYLLAHGISHGILLRKVP FVQYLYYLDQVGIAMSPLSNNALFLTYDKNPFPRYFKRGLNVSLSTDDPLQFSYTREPLI EEYSVAAQIYKLSNVDMCELARNSVLQSGWEAQIKKHWIGKDFDKSGVEGNDVVRTNVPD IRINYRYDTLSTELELVNHFANFKRTIEEK
References
External Links
ResourceLink
Saccharomyces Genome Database AMD1
Uniprot IDP15274
Uniprot NameAMPD_YEAST
GenBank Gene IDM30449
Genebank Protein ID171053
General Reference
  • Meyer, S. L., Kvalnes-Krick, K. L., Schramm, V. L. (1989). "Characterization of AMD, the AMP deaminase gene in yeast. Production of amd strain, cloning, nucleotide sequence, and properties of the protein." Biochemistry 28:8734-8743.2690949
  • Bowman, S., Churcher, C., Badcock, K., Brown, D., Chillingworth, T., Connor, R., Dedman, K., Devlin, K., Gentles, S., Hamlin, N., Hunt, S., Jagels, K., Lye, G., Moule, S., Odell, C., Pearson, D., Rajandream, M., Rice, P., Skelton, J., Walsh, S., Whitehead, S., Barrell, B. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIII." Nature 387:90-93.9169872
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Gruhler, A., Olsen, J. V., Mohammed, S., Mortensen, P., Faergeman, N. J., Mann, M., Jensen, O. N. (2005). "Quantitative phosphoproteomics applied to the yeast pheromone signaling pathway." Mol Cell Proteomics 4:310-327.15665377
  • Li, X., Gerber, S. A., Rudner, A. D., Beausoleil, S. A., Haas, W., Villen, J., Elias, J. E., Gygi, S. P. (2007). "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae." J Proteome Res 6:1190-1197.17330950
  • Chi, A., Huttenhower, C., Geer, L. Y., Coon, J. J., Syka, J. E., Bai, D. L., Shabanowitz, J., Burke, D. J., Troyanskaya, O. G., Hunt, D. F. (2007). "Analysis of phosphorylation sites on proteins from Saccharomyces cerevisiae by electron transfer dissociation (ETD) mass spectrometry." Proc Natl Acad Sci U S A 104:2193-2198.17287358
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956