You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePeroxisomal catalase A
SynonymsNot Available
Gene NameCTA1
Enzyme Class
Biological Properties
General FunctionInvolved in catalase activity
Specific FunctionOccurs in almost all aerobically respiring organisms and serves to protect cells from the toxic effects of hydrogen peroxide
Cellular LocationPeroxisome
SMPDB Pathways
Tryptophan metabolismPW002442 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Methane metabolismec00680 Map00680
Tryptophan metabolismec00380 Map00380
SMPDB ReactionsNot Available
KEGG Reactions
Hydrogen peroxidewater + oxygen
Metabolites
YMDB IDNameView
YMDB00888Hydrogen peroxideShow
YMDB00890waterShow
YMDB00900oxygenShow
GO Classification
Component
Not Available
Function
binding
ion binding
cation binding
metal ion binding
transition metal ion binding
iron ion binding
heme binding
antioxidant activity
peroxidase activity
catalase activity
Process
oxidation reduction
response to stimulus
response to stress
response to oxidative stress
metabolic process
Gene Properties
Chromosome Locationchromosome 4
LocusYDR256C
Gene Sequence>1548 bp ATGTCGAAATTGGGACAAGAAAAAAATGAAGTAAATTACTCTGATGTAAGAGAGGATAGA GTTGTGACAAACTCCACTGGTAATCCAATCAATGAACCATTTGTCACCCAACGTATTGGG GAACATGGCCCTTTGCTTTTGCAAGATTATAACTTAATTGATTCTTTGGCTCATTTCAAC AGGGAAAATATTCCTCAAAGGAATCCACATGCTCATGGTTCTGGTGCCTTCGGCTATTTT GAAGTAACCGATGACATTACTGATATCTGCGGGTCTGCTATGTTTAGTAAAATTGGGAAA AGAACGAAATGTCTAACAAGATTTTCGACTGTGGGTGGTGATAAAGGTAGTGCCGACACG GTTCGTGATCCAAGGGGGTTTGCCACCAAATTCTACACTGAAGAAGGTAATTTAGATTGG GTCTACAATAATACACCGGTATTCTTTATCAGAGACCCTTCCAAGTTCCCTCACTTTATC CACACACAGAAGAGAAACCCACAAACCAACCTAAGGGATGCTGACATGTTTTGGGATTTC CTCACCACTCCTGAAAATCAGGTGGCCATTCATCAAGTAATGATCCTTTTTTCAGACCGT GGTACCCCTGCCAACTACCGTAGTATGCATGGTTATTCTGGTCATACCTATAAATGGTCC AATAAAAACGGAGATTGGCATTATGTGCAAGTTCATATCAAAACCGATCAAGGAATAAAG AATTTGACCATAGAAGAGGCTACCAAAATTGCGGGATCCAATCCAGATTACTGCCAGCAG GATTTATTTGAGGCTATTCAGAATGGAAACTATCCTTCCTGGACAGTTTATATTCAAACA ATGACCGAACGCGATGCCAAAAAATTACCATTTTCAGTCTTTGATTTGACTAAAGTATGG CCTCAGGGGCAATTCCCTTTACGGCGTGTGGGTAAGATTGTTTTGAACGAGAATCCACTG AACTTCTTCGCACAGGTGGAACAAGCTGCCTTCGCCCCCAGTACCACGGTTCCTTACCAA GAAGCAAGCGCTGATCCAGTATTACAGGCCCGTTTGTTTTCATATGCGGATGCTCATAGA TACAGGCTAGGTCCTAACTTCCATCAAATACCCGTAAACTGTCCATATGCATCTAAATTT TTCAATCCCGCTATCAGAGATGGACCGATGAATGTTAACGGCAACTTCGGCTCAGAACCT ACATATTTGGCCAACGATAAATCGTACACGTATATCCAACAGGACAGACCCATTCAACAA CACCAAGAGGTATGGAATGGGCCAGCTATCCCTTATCATTGGGCAACATCCCCAGGTGAT GTAGATTTCGTGCAAGCAAGAAATCTCTACCGCGTTTTGGGTAAACAACCTGGACAGCAA AAGAACTTGGCATATAACATCGGCATTCATGTAGAAGGCGCCTGTCCTCAAATACAGCAG CGCGTTTATGATATGTTTGCTCGTGTTGATAAGGGACTATCTGAGGCAATTAAAAAAGTA GCTGAGGCAAAACATGCTTCTGAGCTTTCGAGTAACTCCAAATTTTGA
Protein Properties
Pfam Domain Function
Protein Residues515
Protein Molecular Weight58555.19922
Protein Theoretical pI7.49
PDB Fileshow
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Peroxisomal catalase A MSKLGQEKNEVNYSDVREDRVVTNSTGNPINEPFVTQRIGEHGPLLLQDYNLIDSLAHFN RENIPQRNPHAHGSGAFGYFEVTDDITDICGSAMFSKIGKRTKCLTRFSTVGGDKGSADT VRDPRGFATKFYTEEGNLDWVYNNTPVFFIRDPSKFPHFIHTQKRNPQTNLRDADMFWDF LTTPENQVAIHQVMILFSDRGTPANYRSMHGYSGHTYKWSNKNGDWHYVQVHIKTDQGIK NLTIEEATKIAGSNPDYCQQDLFEAIQNGNYPSWTVYIQTMTERDAKKLPFSVFDLTKVW PQGQFPLRRVGKIVLNENPLNFFAQVEQAAFAPSTTVPYQEASADPVLQARLFSYADAHR YRLGPNFHQIPVNCPYASKFFNPAIRDGPMNVNGNFGSEPTYLANDKSYTYIQQDRPIQQ HQEVWNGPAIPYHWATSPGDVDFVQARNLYRVLGKQPGQQKNLAYNIGIHVEGACPQIQQ RVYDMFARVDKGLSEAIKKVAEAKHASELSSNSKF
References
External Links
ResourceLink
Saccharomyces Genome Database CTA1
Uniprot IDP15202
Uniprot NameCATA_YEAST
GenBank Gene IDX13028
Genebank Protein ID3605
PDB ID
1A4E
General Reference
  • Cohen, G., Rapatz, W., Ruis, H. (1988). "Sequence of the Saccharomyces cerevisiae CTA1 gene and amino acid sequence of catalase A derived from it." Eur J Biochem 176:159-163.3046940
  • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Mate, M. J., Zamocky, M., Nykyri, L. M., Herzog, C., Alzari, P. M., Betzel, C., Koller, F., Fita, I. (1999). "Structure of catalase-A from Saccharomyces cerevisiae." J Mol Biol 286:135-149.9931255