You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameBile pigment transporter 1
SynonymsNot Available
Gene NameBPT1
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in ATP binding
Specific FunctionCooperates for the ATP-dependent vacuolar transport of bilirubin and glutathione conjugates
Cellular LocationVacuole membrane; Multi-pass membrane protein
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00160GlutathioneShow
GO Classification
Component
cell part
membrane part
intrinsic to membrane
integral to membrane
Function
hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
ATP binding
primary active transmembrane transporter activity
catalytic activity
nucleotide binding
P-P-bond-hydrolysis-driven transmembrane transporter activity
transporter activity
ATPase activity, coupled to transmembrane movement of substances
transmembrane transporter activity
pyrophosphatase activity
active transmembrane transporter activity
nucleoside-triphosphatase activity
ATPase activity
binding
nucleoside binding
purine nucleoside binding
hydrolase activity
adenyl nucleotide binding
hydrolase activity, acting on acid anhydrides
adenyl ribonucleotide binding
Process
transmembrane transport
establishment of localization
transport
Gene Properties
Chromosome Locationchromosome 12
LocusYLL015W
Gene Sequence>4680 bp ATGTCTTCACTAGAAGTGGTAGATGGGTGCCCCTATGGATACCGACCATATCCAGATAGT GGCACAAATGCATTAAATCCATGTTTTATATCAGTAATATCCGCCTGGCAAGCCGTCTTT TTCCTATTGATTGGTAGCTATCAATTGTGGAAACTTTATAAGAACAATAAAGTACCACCC AGATTTAAGAACTTTCCTACATTACCAAGTAAAATCAACAGTCGACATCTAACGCATTTG ACCAATGTTTGCTTTCAGTCCACGCTTATAATTTGTGAACTGGCCTTGGTATCCCAATCT AGCGATAGGGTTTATCCATTTATACTAAAGAAGGCTCTGTACTTGAATCTCCTTTTCAAT TTGGGTATTTCTCTCCCTACTCAATACTTAGCTTATTTTAAAAGTACATTTTCAATGGGC AACCAGCTTTTCTATTACATGTTTCAAATTCTTCTACAGCTCTTCTTGATATTGCAGAGG TACTATCATGGTTCTAGTAACGAAAGGCTTACTGTTATTAGCGGACAAACTGCTATGATT TTAGAAGTGCTCCTTCTTTTCAATTCTGTGGCAATTTTTATTTATGATCTATGCATTTTT GAGCCAATTAACGAATTATCTGAATACTACAAGAAAAATGGGTGGTATCCCCCCGTTCAT GTACTATCCTATATTACATTTATCTGGATGAACAAACTGATTGTGGAAACTTACCGTAAC AAGAAAATCAAAGATCCTAACCAGTTACCATTGCCGCCAGTAGATCTGAATATTAAGTCG ATAAGTAAGGAATTTAAGGCTAACTGGGAATTGGAAAAATGGTTGAATAGAAATTCTCTT TGGAGGGCCATTTGGAAGTCATTTGGTAGGACTATTTCTGTGGCTATGCTGTATGAAACG ACATCTGATTTACTTTCTGTAGTACAGCCCCAGTTTCTACGGATATTCATAGATGGTTTG AACCCGGAAACATCTTCTAAATATCCTCCTTTAAATGGTGTATTTATTGCTCTAACCCTT TTCGTAATCAGCGTGGTTTCTGTGTTCCTCACCAATCAATTTTATATTGGAATTTTTGAG GCTGGTTTGGGGATAAGAGGCTCTTTAGCTTCTTTAGTGTATCAGAAGTCCTTAAGATTG ACGCTAGCAGAGCGTAACGAAAAATCTACTGGTGACATCTTAAATTTGATGTCTGTGGAT GTGTTAAGGATCCAGCGGTTTTTCGAAAATGCCCAAACCATTATTGGCGCTCCTATTCAG ATTATTGTTGTATTAACTTCCCTGTACTGGTTGCTAGGAAAGGCTGTTATTGGAGGGTTG GTTACTATGGCTATTATGATGCCTATCAATGCCTTCTTATCTAGAAAGGTAAAAAAGCTA TCAAAAACTCAAATGAAGTATAAGGACATGAGAATCAAGACTATTACAGAGCTTTTGAAT GCTATAAAATCTATTAAATTATACGCCTGGGAGGAACCTATGATGGCAAGATTGAATCAT GTTCGTAATGATATGGAGTTGAAAAATTTTCGGAAAATTGGTATAGTGAGCAATCTGATA TATTTTGCGTGGAATTGTGTACCTTTAATGGTGACATGTTCCACATTTGGCTTATTTTCT TTATTTAGTGATTCTCCGTTATCTCCTGCCATTGTCTTCCCTTCATTATCTTTATTTAAT ATTTTGAACAGTGCCATCTATTCCGTTCCATCCATGATAAATACCATTATAGAGACAAGC GTTTCTATGGAAAGATTAAAGTCATTCCTACTTAGTGACGAAATTGATGATTCGTTCATC GAACGTATTGATCCTTCAGCGGATGAAAGAGCGTTACCTGCTATAGAGATGAATAATATT ACATTTTTATGGAAATCAAAAGAAGTATTAACATCTAGCCAATCTGGAGATAATTTGAGG ACAGATGAAGAGTCTATTATCGGATCTTCTCAAATTGCGTTGAAGAATATCGATCATTTT GAAGCAAAAAGGGGTGATTTAGTTTGTGTTGTTGGTCGGGTAGGAGCTGGTAAATCAACA TTTTTGAAGGCAATTCTTGGTCAACTTCCTTGCATGAGTGGTTCTAGGGACTCGATACCA CCTAAACTGATCATTAGATCATCGTCTGTAGCCTACTGTTCACAAGAATCCTGGATAATG AACGCATCTGTAAGAGAAAACATTCTATTTGGTCACAAGTTCGACCAAGATTATTATGAC CTCACTATTAAAGCATGTCAATTGCTACCCGATTTGAAAATACTACCAGATGGTGATGAA ACTTTGGTAGGTGAAAAGGGCATTTCCCTATCAGGCGGTCAGAAGGCCCGTCTTTCATTA GCCAGAGCGGTGTACTCGAGAGCAGATATTTATTTGTTGGATGACATTTTATCTGCTGTT GATGCAGAAGTTAGTAAAAATATTATTGAATATGTTTTGATCGGAAAGACGGCTTTATTA AAAAATAAAACAATTATTTTAACTACCAATACTGTATCAATTTTAAAACATTCGCAGATG ATATATGCGCTAGAAAACGGTGAAATTGTTGAACAAGGGAATTATGAGGATGTAATGAAC CGTAAGAACAATACTTCAAAACTGAAAAAATTACTAGAGGAATTTGATTCTCCGATTGAT AATGGAAATGAAAGCGATGTCCAAACTGAACACCGATCCGAAAGTGAAGTGGATGAACCT CTGCAGCTTAAAGTAACTGAATCAGAAACTGAGGATGAGGTTGTTACTGAGAGTGAATTA GAACTAATCAAAGCCAATTCTAGAAGAGCTTCTCTAGCTACGCTAAGACCTAGACCCTTT GTGGGAGCACAATTGGATTCCGTGAAGAAAACGGCGCAAAAGGCCGAGAAGACAGAGGTG GGAAGAGTCAAAACAAAGATTTATCTTGCGTATATTAAGGCTTGTGGAGTTTTAGGTGTT GTTTTATTTTTCTTGTTTATGATATTAACAAGGGTTTTCGACTTAGCAGAGAATTTTTGG TTAAAGTACTGGTCAGAATCTAATGAAAAAAATGGTTCAAATGAAAGGGTTTGGATGTTT GTTGGTGTGTATTCCTTAATCGGAGTAGCATCGGCCGCATTCAATAATTTACGGAGTATT ATGATGCTACTGTATTGTTCTATTAGGGGTTCTAAGAAACTGCATGAAAGCATGGCCAAA TCTGTAATTAGAAGTCCTATGACTTTCTTTGAGACTACACCAGTTGGAAGGATCATAAAC AGGTTCTCATCTGATATGGATGCAGTGGACAGTAATCTACAGTACATTTTCTCCTTTTTT TTCAAATCAATACTAACCTATTTGGTTACTGTTATATTAGTCGGGTACAATATGCCATGG TTTTTAGTGTTCAATATGTTTTTGGTGGTTATCTATATTTACTATCAAACATTTTACATT GTGCTATCTAGGGAGCTAAAAAGATTGATCAGTATATCTTACTCTCCGATTATGTCCTTA ATGAGTGAGAGCTTGAACGGTTATTCTATTATTGATGCATACGATCATTTTGAGAGATTC ATCTATCTAAATTATGAAAAAATCCAATACAACGTTGATTTTGTCTTCAACTTTAGATCA ACGAATAGATGGTTATCCGTGAGATTGCAAACTATTGGTGCTACAATTGTTTTGGCTACT GCAATCTTAGCACTAGCAACAATGAATACTAAAAGGCAACTAAGTTCGGGTATGGTTGGT CTACTAATGAGCTATTCATTAGAGGTTACAGGTTCATTGACTTGGATTGTAAGGACAACT GTGACGATTGAAACCAACATTGTATCAGTGGAGAGAATTGTTGAGTACTGCGAATTACCA CCTGAAGCACAGTCCATTAACCCTGAAAAGAGGCCAGATGAAAATTGGCCATCAAAGGGT GGTATTGAATTCAAAAACTATTCCACAAAATACAGAGAAAATTTGGATCCAGTGCTGAAT AATATTAACGTGAAGATTGAGCCATGTGAAAAGGTTGGGATTGTTGGCAGAACAGGTGCA GGGAAGTCTACACTGAGCCTGGCATTATTTAGAATACTAGAACCTACCGAAGGTAAAATT ATTATTGACGGCATTGATATATCCGACATAGGTCTGTTCGATTTAAGAAGCCATTTGGCA ATTATTCCTCAGGATGCACAAGCTTTTGAAGGTACAGTAAAGACCAATTTGGACCCTTTC AATCGTTATTCAGAAGATGAACTTAAAAGGGCTGTTGAGCAGGCACATTTAAAGCCTCAT CTGGAAAAAATGCTGCACAGTAAACCAAGAGGTGATGATTCTAATGAAGAGGATGGCAAT GTTAATGATATTCTGGATGTCAAGATTAATGAGAACGGTAGTAACTTGTCAGTGGGGCAA AGACAACTACTATGTTTGGCAAGAGCGCTGCTAAACCGTTCCAAAATATTGGTCCTTGAT GAAGCAACGGCTTCTGTGGATATGGAAACCGATAAAATTATCCAAGACACTATAAGAAGA GAATTTAAGGACCGTACCATCTTAACAATTGCACATCGTATCGACACTGTATTGGACAGT GATAAGATAATTGTTCTTGACCAGGGTAGTGTGAGGGAATTCGATTCACCCTCGAAATTG TTATCCGATAAAACGTCTATTTTTTACAGTCTTTGTGAGAAAGGTGGGTATTTGAAATAA
Protein Properties
Pfam Domain Function
Protein Residues1559
Protein Molecular Weight176872.0
Protein Theoretical pI7.73
Signalling Regions
  • None
Transmembrane Regions
  • 30-50
  • 85-105
  • 111-127
  • 140-160
  • 179-199
  • 284-304
  • 334-354
  • 411-431
  • 435-455
  • 519-539
  • 561-581
  • 973-993
  • 1031-1052
  • 1096-1116
  • 1118-1138
  • 1210-1230
  • 1236-1256
Protein Sequence>Bile pigment transporter 1 MSSLEVVDGCPYGYRPYPDSGTNALNPCFISVISAWQAVFFLLIGSYQLWKLYKNNKVPP RFKNFPTLPSKINSRHLTHLTNVCFQSTLIICELALVSQSSDRVYPFILKKALYLNLLFN LGISLPTQYLAYFKSTFSMGNQLFYYMFQILLQLFLILQRYYHGSSNERLTVISGQTAMI LEVLLLFNSVAIFIYDLCIFEPINELSEYYKKNGWYPPVHVLSYITFIWMNKLIVETYRN KKIKDPNQLPLPPVDLNIKSISKEFKANWELEKWLNRNSLWRAIWKSFGRTISVAMLYET TSDLLSVVQPQFLRIFIDGLNPETSSKYPPLNGVFIALTLFVISVVSVFLTNQFYIGIFE AGLGIRGSLASLVYQKSLRLTLAERNEKSTGDILNLMSVDVLRIQRFFENAQTIIGAPIQ IIVVLTSLYWLLGKAVIGGLVTMAIMMPINAFLSRKVKKLSKTQMKYKDMRIKTITELLN AIKSIKLYAWEEPMMARLNHVRNDMELKNFRKIGIVSNLIYFAWNCVPLMVTCSTFGLFS LFSDSPLSPAIVFPSLSLFNILNSAIYSVPSMINTIIETSVSMERLKSFLLSDEIDDSFI ERIDPSADERALPAIEMNNITFLWKSKEVLTSSQSGDNLRTDEESIIGSSQIALKNIDHF EAKRGDLVCVVGRVGAGKSTFLKAILGQLPCMSGSRDSIPPKLIIRSSSVAYCSQESWIM NASVRENILFGHKFDQDYYDLTIKACQLLPDLKILPDGDETLVGEKGISLSGGQKARLSL ARAVYSRADIYLLDDILSAVDAEVSKNIIEYVLIGKTALLKNKTIILTTNTVSILKHSQM IYALENGEIVEQGNYEDVMNRKNNTSKLKKLLEEFDSPIDNGNESDVQTEHRSESEVDEP LQLKVTESETEDEVVTESELELIKANSRRASLATLRPRPFVGAQLDSVKKTAQKAEKTEV GRVKTKIYLAYIKACGVLGVVLFFLFMILTRVFDLAENFWLKYWSESNEKNGSNERVWMF VGVYSLIGVASAAFNNLRSIMMLLYCSIRGSKKLHESMAKSVIRSPMTFFETTPVGRIIN RFSSDMDAVDSNLQYIFSFFFKSILTYLVTVILVGYNMPWFLVFNMFLVVIYIYYQTFYI VLSRELKRLISISYSPIMSLMSESLNGYSIIDAYDHFERFIYLNYEKIQYNVDFVFNFRS TNRWLSVRLQTIGATIVLATAILALATMNTKRQLSSGMVGLLMSYSLEVTGSLTWIVRTT VTIETNIVSVERIVEYCELPPEAQSINPEKRPDENWPSKGGIEFKNYSTKYRENLDPVLN NINVKIEPCEKVGIVGRTGAGKSTLSLALFRILEPTEGKIIIDGIDISDIGLFDLRSHLA IIPQDAQAFEGTVKTNLDPFNRYSEDELKRAVEQAHLKPHLEKMLHSKPRGDDSNEEDGN VNDILDVKINENGSNLSVGQRQLLCLARALLNRSKILVLDEATASVDMETDKIIQDTIRR EFKDRTILTIAHRIDTVLDSDKIIVLDQGSVREFDSPSKLLSDKTSIFYSLCEKGGYLK
References
External Links
ResourceLink
Saccharomyces Genome Database BPT1
Uniprot IDP14772
Uniprot NameBPT1_YEAST
GenBank Gene IDX91488
Genebank Protein ID1495208
General Reference
  • Miosga, T., Zimmermann, F. K. (1996). "Sequence analysis of the CEN12 region of Saccharomyces cerevisiae on a 43.7 kb fragment of chromosome XII including an open reading frame homologous to the human cystic fibrosis transmembrane conductance regulator protein CFTR." Yeast 12:693-708.8810043
  • Purnelle, B., Goffeau, A. (1997). "The sequence of 32b on the left arm of yeast chromosome XII reveals six known genes, a new member of the seripauperins family and a new ABS transporter homologous to the human multidrug resistance protein." Yeast 13:183-188.9046100
  • Johnston, M., Hillier, L., Riles, L., Albermann, K., Andre, B., Ansorge, W., Benes, V., Bruckner, M., Delius, H., Dubois, E., Dusterhoft, A., Entian, K. D., Floeth, M., Goffeau, A., Hebling, U., Heumann, K., Heuss-Neitzel, D., Hilbert, H., Hilger, F., Kleine, K., Kotter, P., Louis, E. J., Messenguy, F., Mewes, H. W., Hoheisel, J. D., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XII." Nature 387:87-90.9169871
  • Boy-Marcotte, E., Damak, F., Camonis, J., Garreau, H., Jacquet, M. (1989). "The C-terminal part of a gene partially homologous to CDC 25 gene suppresses the cdc25-5 mutation in Saccharomyces cerevisiae." Gene 77:21-30.2545538
  • Petrovic, S., Pascolo, L., Gallo, R., Cupelli, F., Ostrow, J. D., Goffeau, A., Tiribelli, C., Bruschi, C. V. (2000). "The products of YCF1 and YLL015w (BPT1) cooperate for the ATP-dependent vacuolar transport of unconjugated bilirubin in Saccharomyces cerevisiae." Yeast 16:561-571.10790694
  • Klein, M., Mamnun, Y. M., Eggmann, T., Schuller, C., Wolfger, H., Martinoia, E., Kuchler, K. (2002). "The ATP-binding cassette (ABC) transporter Bpt1p mediates vacuolar sequestration of glutathione conjugates in yeast." FEBS Lett 520:63-67.12044871
  • Gruhler, A., Olsen, J. V., Mohammed, S., Mortensen, P., Faergeman, N. J., Mann, M., Jensen, O. N. (2005). "Quantitative phosphoproteomics applied to the yeast pheromone signaling pathway." Mol Cell Proteomics 4:310-327.15665377
  • Kim, H., Melen, K., Osterberg, M., von Heijne, G. (2006). "A global topology map of the Saccharomyces cerevisiae membrane proteome." Proc Natl Acad Sci U S A 103:11142-11147.16847258
  • Li, X., Gerber, S. A., Rudner, A. D., Beausoleil, S. A., Haas, W., Villen, J., Elias, J. E., Gygi, S. P. (2007). "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae." J Proteome Res 6:1190-1197.17330950
  • Chi, A., Huttenhower, C., Geer, L. Y., Coon, J. J., Syka, J. E., Bai, D. L., Shabanowitz, J., Burke, D. J., Troyanskaya, O. G., Hunt, D. F. (2007). "Analysis of phosphorylation sites on proteins from Saccharomyces cerevisiae by electron transfer dissociation (ETD) mass spectrometry." Proc Natl Acad Sci U S A 104:2193-2198.17287358
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956