You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameFructose-bisphosphate aldolase
Synonyms
  • FBP aldolase
  • FBPA
  • Fructose-1,6-bisphosphate aldolase
Gene NameFBA1
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionCatalyzes the aldol condensation of dihydroxyacetone phosphate (DHAP or glycerone-phosphate) with glyceraldehyde 3- phosphate (G3P) to form fructose 1,6-bisphosphate (FBP) in gluconeogenesis and the reverse reaction in glycolysis
Cellular LocationNot Available
SMPDB PathwaysNot Available
KEGG Pathways
Fructose and mannose metabolismec00051 Map00051
Glycolysis / Gluconeogenesisec00010 Map00010
Methane metabolismec00680 Map00680
Pentose phosphate pathwayec00030 Map00030
SMPDB ReactionsNot Available
KEGG Reactions
D-fructose 1-phosphateD-glyceraldehyde + Dihydroxyacetone phosphate
Fructose 1,6-bisphosphateD-Glyceraldehyde 3-phosphate + Dihydroxyacetone phosphate
sedoheptulose 1,7-bisphosphateD-Erythrose 4-phosphate + Dihydroxyacetone phosphate
Metabolites
YMDB IDNameView
YMDB00108Fructose 1,6-bisphosphateShow
YMDB00115D-Glyceraldehyde 3-phosphateShow
YMDB00223D-Erythrose 4-phosphateShow
YMDB00322Dihydroxyacetone phosphateShow
YMDB00575D-glyceraldehydeShow
YMDB00655D-fructose 1-phosphateShow
YMDB00687D-fructose 1,6-bisphosphateShow
YMDB00753sedoheptulose 1,7-bisphosphateShow
GO Classification
Component
Not Available
Function
zinc ion binding
catalytic activity
aldehyde-lyase activity
fructose-bisphosphate aldolase activity
lyase activity
carbon-carbon lyase activity
binding
ion binding
cation binding
metal ion binding
transition metal ion binding
Process
small molecule metabolic process
alcohol metabolic process
monosaccharide metabolic process
hexose metabolic process
glucose metabolic process
glucose catabolic process
glycolysis
metabolic process
Gene Properties
Chromosome Locationchromosome 11
LocusYKL060C
Gene Sequence>1080 bp ATGGGTGTTGAACAAATCTTAAAGAGAAAGACCGGTGTCATCGTTGGTGAAGATGTCCAC AACTTATTCACTTACGCTAAGGAACACAAGTTCGCTATTCCAGCTATTAACGTCACCTCT TCTTCTACTGCCGTCGCTGCTTTAGAAGCTGCTAGAGACAGCAAGTCCCCAATCATTTTG CAAACCTCTAACGGTGGTGCTGCTTACTTCGCTGGTAAGGGTATCTCTAACGAAGGTCAA AATGCTTCCATCAAGGGTGCTATTGCCGCTGCCCACTACATCAGATCCATTGCTCCAGCT TACGGTATCCCAGTTGTCTTACACTCTGACCACTGTGCCAAGAAGTTGTTGCCATGGTTC GATGGTATGTTGGAAGCTGATGAAGCTTACTTCAAGGAACACGGTGAACCATTATTCTCC TCCCACATGTTGGATTTGTCTGAAGAAACCGATGAAGAAAACATCTCTACTTGTGTCAAG TACTTCAAGAGAATGGCCGCTATGGACCAATGGTTAGAAATGGAAATCGGTATTACCGGT GGTGAAGAAGATGGTGTTAACAACGAAAACGCTGACAAGGAAGACTTGTACACCAAGCCA GAACAAGTTTACAACGTCTACAAGGCTTTGCACCCAATCTCTCCAAACTTCTCCATTGCT GCTGCTTTCGGTAACTGTCACGGTTTGTACGCTGGTGACATCGCTTTGAGACCAGAAATC TTGGCTGAACACCAAAAGTACACCAGAGAACAAGTTGGTTGCAAGGAAGAAAAGCCATTG TTCTTGGTCTTCCACGGTGGTTCCGGTTCTACTGTCCAAGAATTCCACACTGGTATTGAC AACGGTGTTGTCAAGGTCAACTTGGACACTGACTGTCAATACGCTTACTTGACTGGTATC AGAGACTACGTCTTGAACAAGAAGGACTACATAATGTCCCCAGTCGGTAACCCAGAAGGT CCAGAAAAGCCAAACAAGAAGTTCTTCGACCCAAGAGTCTGGGTTAGAGAAGGTGAAAAG ACCATGGGTGCTAAGATCACCAAGTCTTTGGAAACTTTCCGTACCACTAACACTTTATAA
Protein Properties
Pfam Domain Function
Protein Residues359
Protein Molecular Weight39620.5
Protein Theoretical pI5.59
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Fructose-bisphosphate aldolase MGVEQILKRKTGVIVGEDVHNLFTYAKEHKFAIPAINVTSSSTAVAALEAARDSKSPIIL QTSNGGAAYFAGKGISNEGQNASIKGAIAAAHYIRSIAPAYGIPVVLHSDHCAKKLLPWF DGMLEADEAYFKEHGEPLFSSHMLDLSEETDEENISTCVKYFKRMAAMDQWLEMEIGITG GEEDGVNNENADKEDLYTKPEQVYNVYKALHPISPNFSIAAAFGNCHGLYAGDIALRPEI LAEHQKYTREQVGCKEEKPLFLVFHGGSGSTVQEFHTGIDNGVVKVNLDTDCQYAYLTGI RDYVLNKKDYIMSPVGNPEGPEKPNKKFFDPRVWVREGEKTMGAKITKSLETFRTTNTL
References
External Links
ResourceLink
Saccharomyces Genome Database FBA1
Uniprot IDP14540
Uniprot NameALF_YEAST
GenBank Gene IDX15003
Genebank Protein ID3696
General Reference
  • Schwelberger, H. G., Kohlwein, S. D., Paltauf, F. (1989). "Molecular cloning, primary structure and disruption of the structural gene of aldolase from Saccharomyces cerevisiae." Eur J Biochem 180:301-308.2647491
  • Dujon, B., Alexandraki, D., Andre, B., Ansorge, W., Baladron, V., Ballesta, J. P., Banrevi, A., Bolle, P. A., Bolotin-Fukuhara, M., Bossier, P., et, a. l. .. (1994). "Complete DNA sequence of yeast chromosome XI." Nature 369:371-378.8196765
  • Rasmussen, S. W. (1994). "Sequence of a 28.6 kb region of yeast chromosome XI includes the FBA1 and TOA2 genes, an open reading frame (ORF) similar to a translationally controlled tumour protein, one ORF containing motifs also found in plant storage proteins and 13 ORFs with weak or no homology to known proteins." Yeast 10 Suppl A:S63-S68.8091862
  • Gatignol, A., Dassain, M., Tiraby, G. (1990). "Cloning of Saccharomyces cerevisiae promoters using a probe vector based on phleomycin resistance." Gene 91:35-41.1698168
  • Garrels, J. I., Futcher, B., Kobayashi, R., Latter, G. I., Schwender, B., Volpe, T., Warner, J. R., McLaughlin, C. S. (1994). "Protein identifications for a Saccharomyces cerevisiae protein database." Electrophoresis 15:1466-1486.7895733
  • Norbeck, J., Blomberg, A. (1996). "Protein expression during exponential growth in 0.7 M NaCl medium of Saccharomyces cerevisiae." FEMS Microbiol Lett 137:1-8.8935650
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Li, X., Gerber, S. A., Rudner, A. D., Beausoleil, S. A., Haas, W., Villen, J., Elias, J. E., Gygi, S. P. (2007). "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae." J Proteome Res 6:1190-1197.17330950
  • Chi, A., Huttenhower, C., Geer, L. Y., Coon, J. J., Syka, J. E., Bai, D. L., Shabanowitz, J., Burke, D. J., Troyanskaya, O. G., Hunt, D. F. (2007). "Analysis of phosphorylation sites on proteins from Saccharomyces cerevisiae by electron transfer dissociation (ETD) mass spectrometry." Proc Natl Acad Sci U S A 104:2193-2198.17287358
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956