You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameChitin synthase 2
Synonyms
  • Chitin-UDP acetyl-glucosaminyl transferase 2
Gene NameCHS2
Enzyme Class
Biological Properties
General FunctionInvolved in chitin synthase activity
Specific FunctionEssential for septum formation and cell division. CHS2 is required for maintaining normal cell morphology
Cellular LocationMembrane; Multi-pass membrane protein
SMPDB Pathways
Amino sugar and nucleotide sugar metabolismPW002413 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Amino sugar and nucleotide sugar metabolismec00520 Map00520
SMPDB Reactions
Uridine diphosphate-N-acetylglucosamine + ChitinUridine 5'-diphosphate + Chitin
KEGG Reactions
Uridine diphosphate-N-acetylglucosamine → chitin + Uridine 5'-diphosphate + hydron
Metabolites
YMDB IDNameView
YMDB00277Uridine diphosphate-N-acetylglucosamineShow
YMDB00307Uridine 5'-diphosphateShow
YMDB00862hydronShow
YMDB16156ChitinShow
GO Classification
Component
Not Available
Function
transferase activity
transferase activity, transferring glycosyl groups
UDP-glycosyltransferase activity
acetylglucosaminyltransferase activity
chitin synthase activity
catalytic activity
Process
metabolic process
primary metabolic process
carbohydrate metabolic process
polysaccharide metabolic process
polysaccharide biosynthetic process
aminoglycan biosynthetic process
chitin biosynthetic process
Gene Properties
Chromosome Locationchromosome 2
LocusYBR038W
Gene Sequence>2892 bp ATGACGAGAAACCCGTTTATGGTGGAACCTTCGAATGGCTCTCCTAATAGACGTGGTGCT TCAAACCTCTCCAAATTTTACGCAAACGCTAACAGCAACTCTCGGTGGGCTAATCCCAGT GAGGAGAGTTTGGAGGATAGCTATGACCAATCTAACGTTTTCCAAGGCCTTCCGGCATCT CCTTCGAGAGCTGCACTAAGATACTCCCCAGACCGTCGCCATAGAACTCAATTTTACCGC GATAGTGCCCATAACTCTCCAGTTGCTCCGAACAGGTATGCTGCTAATCTACAAGAGTCT CCCAAAAGAGCAGGCGAGGCTGTCATACATCTAAGTGAGGGGAGTAACCTTTACCCCCGC GATAATGCAGATCTACCGGTAGACCCCTACCATCTATCACCCCAGCAACAGCCCAGTAAC AATCTGTTTGGAAGTGGCAGATTGTATTCTCAAAGCTCGAAATACACGATGTCTACTACT TCCACAACGGCTCCCTCTCTGGCAGAAGCAGACGATGAAAAGGAAAAATACCTCACTTCG ACTACTTCCTATGATGATCAGTCTACAATTTTCTCTGCAGACACTTTCAATGAAACAAAA TTTGAACTGAACCATCCAACAAGACAGCAGTATGTAAGACGTGCCAATTCTGAGAGTAAG AGAAGAATGGTCTCAGACTTGCCTCCCCCAAGCAAGAAGAAGGCACTATTGAAACTAGAC AACCCGATACCAAAAGGTCTGTTGGATACTTTGCCTCGTAGGAACTCCCCTGAGTTTACG GAAATGAGATATACAGCCTGCACTGTGGAACCTGACGATTTTTTGAGAGAAGGTTACACT TTGAGATTCGCAGAGATGAACAGAGAATGTCAAATTGCCATTTGTATTACCATGTACAAT GAAGATAAATATTCATTGGCAAGAACCATCCACTCCATTATGAAGAATGTTGCTCATCTT TGTAAGCGTGAAAAATCTCATGTTTGGGGCCCCAATGGCTGGAAGAAAGTCTCTGTAATT CTGATTAGTGACGGTAGAGCAAAAGTCAACCAAGGGTCTCTCGACTATTTAGCTGCTTTG GGTGTTTATCAAGAAGATATGGCCAAGGCGTCTGTGAATGGTGATCCGGTAAAAGCGCAC ATTTTTGAATTGACAACTCAGGTCTCTATCAACGCCGATCTGGATTATGTTTCAAAGGAC ATTGTTCCTGTGCAATTGGTTTTTTGTCTAAAAGAAGAAAATAAGAAAAAGATCAATTCC CATCGTTGGCTATTCAACGCGTTTTGTCCCGTTTTGCAACCTACTGTAGTTACTTTGGTT GATGTCGGTACACGTTTAAACAATACAGCAATTTACAGGTTATGGAAGGTTTTTGATATG GATTCAAATGTGGCTGGTGCGGCTGGTCAGATTAAGACTATGAAGGGGAAGTGGGGACTG AAACTTTTCAATCCATTAGTTGCATCGCAAAATTTTGAATATAAGATCTCGAATATTTTA GATAAACCATTAGAAAGTGTTTTTGGTTATATCTCTGTTCTTCCTGGTGCCCTGTCCGCA TATAGGTATAGAGCCTTAAAAAATCATGAAGATGGCACTGGCCCTCTCAGATCGTATTTC CTTGGTGAAACTCAAGAAGGCAGAGACCATGATGTTTTCACTGCAAATATGTACTTGGCT GAAGATAGAATTCTTTGTTGGGAATTGGTCGCCAAGCGAGATGCAAAATGGGTTCTAAAA TATGTTAAGGAAGCCACTGGTGAAACGGATGTTCCCGAAGACGTTTCTGAATTTATTTCT CAAAGAAGACGTTGGTTAAATGGTGCAATGTTTGCCGCAATTTATGCTCAATTGCATTTC TACCAAATTTGGAAAACTAAACATTCTGTTGTACGCAAGTTCTTTCTTCATGTTGAATTC CTTTATCAATTTATTCAGATGCTTTTTTCCTGGTTTTCTATTGCAAATTTCGTTCTTACC TTTTATTATTTAGCAGGATCAATGAATTTAGTTATTAAACATGGTGAGGCCTTATTCATT TTTTTTAAATACCTGATCTTTTGTGACTTGGCAAGTTTATTCATTATTTCCATGGGTAAT AGACCCCAGGGCGCGAAACATTTATTCATTACCTCCATGGTTATACTGTCTATATGTGCC ACATATTCTCTAATTTGTGGGTTTGTTTTTGCTTTCAAGTCGTTAGCTTCTGGAACGGAA TCCCACAAAATATTTGTCGACATCGTTATCTCATTGCTCTCCACCTATGGCCTATACTTT TTCTCATCACTGATGTACCTAGATCCTTGGCACATGTTTACATCATCCATACAATACTTT TTGACACTTCCCGCCTTTACGTGTACTTTACAGATTTTTGCCTTCTGTAATACACACGAC GTTTCCTGGGGTACTAAAGGTTCCACACAGGAGTCCAAGCAATTGTCCAAGGCCATTGTC GTTCAAGGTCCAGATGGGAAACAGATTGTGGAAACAGATTGGCCTCAGGAAGTTGATAAG AAGTTTTTGGAAATAAAAAGTCGTTTGAAAGAACCAGAATTTGAAGAATCAAGCGGCAAT GAAAAACAATCCAAGAATGATTATTATAGAGATATAAGAACCAGAATTGTGATGATTTGG ATGCTATCAAATCTAATACTGATCATGTCTATAATTCAAGTCTTTACACCACAAGATACT GACAATGGTTATTTGATATTCATTTTATGGTCTGTGGCCGCTTTAGCTGCCTTTAGGGTG GTTGGTTCCATGGCCTTTTTGTTCATGAAATACTTGCGTATAATAGTGAGTTACAGAAAT AAAGTTGAAGGTAGCGGCTCATGGGAAGTCTCTAAATTAGACTTACCAAATGTTTTCCAC AAAAAGGGCTAA
Protein Properties
Pfam Domain Function
Protein Residues963
Protein Molecular Weight109881.0
Protein Theoretical pI8.86
Signalling Regions
  • None
Transmembrane Regions
  • 644-664
  • 678-698
  • 712-732
  • 744-764
  • 776-796
  • 876-896
  • 906-926
Protein Sequence>Chitin synthase 2 MTRNPFMVEPSNGSPNRRGASNLSKFYANANSNSRWANPSEESLEDSYDQSNVFQGLPAS PSRAALRYSPDRRHRTQFYRDSAHNSPVAPNRYAANLQESPKRAGEAVIHLSEGSNLYPR DNADLPVDPYHLSPQQQPSNNLFGSGRLYSQSSKYTMSTTSTTAPSLAEADDEKEKYLTS TTSYDDQSTIFSADTFNETKFELNHPTRQQYVRRANSESKRRMVSDLPPPSKKKALLKLD NPIPKGLLDTLPRRNSPEFTEMRYTACTVEPDDFLREGYTLRFAEMNRECQIAICITMYN EDKYSLARTIHSIMKNVAHLCKREKSHVWGPNGWKKVSVILISDGRAKVNQGSLDYLAAL GVYQEDMAKASVNGDPVKAHIFELTTQVSINADLDYVSKDIVPVQLVFCLKEENKKKINS HRWLFNAFCPVLQPTVVTLVDVGTRLNNTAIYRLWKVFDMDSNVAGAAGQIKTMKGKWGL KLFNPLVASQNFEYKISNILDKPLESVFGYISVLPGALSAYRYRALKNHEDGTGPLRSYF LGETQEGRDHDVFTANMYLAEDRILCWELVAKRDAKWVLKYVKEATGETDVPEDVSEFIS QRRRWLNGAMFAAIYAQLHFYQIWKTKHSVVRKFFLHVEFLYQFIQMLFSWFSIANFVLT FYYLAGSMNLVIKHGEALFIFFKYLIFCDLASLFIISMGNRPQGAKHLFITSMVILSICA TYSLICGFVFAFKSLASGTESHKIFVDIVISLLSTYGLYFFSSLMYLDPWHMFTSSIQYF LTLPAFTCTLQIFAFCNTHDVSWGTKGSTQESKQLSKAIVVQGPDGKQIVETDWPQEVDK KFLEIKSRLKEPEFEESSGNEKQSKNDYYRDIRTRIVMIWMLSNLILIMSIIQVFTPQDT DNGYLIFILWSVAALAAFRVVGSMAFLFMKYLRIIVSYRNKVEGSGSWEVSKLDLPNVFH KKG
References
External Links
ResourceLink
Saccharomyces Genome Database CHS2
Uniprot IDP14180
Uniprot NameCHS2_YEAST
GenBank Gene IDM23865
Genebank Protein ID171220
General Reference
  • Silverman, S. J. (1989). "Similar and different domains of chitin synthases 1 and 2 of S. cerevisiae: two isozymes with distinct functions." Yeast 5:459-467.2533436
  • Feldmann, H., Aigle, M., Aljinovic, G., Andre, B., Baclet, M. C., Barthe, C., Baur, A., Becam, A. M., Biteau, N., Boles, E., Brandt, T., Brendel, M., Bruckner, M., Bussereau, F., Christiansen, C., Contreras, R., Crouzet, M., Cziepluch, C., Demolis, N., Delaveau, T., Doignon, F., Domdey, H., Dusterhus, S., Dubois, E., Dujon, B., El Bakkoury, M., Entian, K. D., Feurmann, M., Fiers, W., Fobo, G. M., Fritz, C., Gassenhuber, H., Glandsdorff, N., Goffeau, A., Grivell, L. A., de Haan, M., Hein, C., Herbert, C. J., Hollenberg, C. P., Holmstrom, K., Jacq, C., Jacquet, M., Jauniaux, J. C., Jonniaux, J. L., Kallesoe, T., Kiesau, P., Kirchrath, L., Kotter, P., Korol, S., Liebl, S., Logghe, M., Lohan, A. J., Louis, E. J., Li, Z. Y., Maat, M. J., Mallet, L., Mannhaupt, G., Messenguy, F., Miosga, T., Molemans, F., Muller, S., Nasr, F., Obermaier, B., Perea, J., Pierard, A., Piravandi, E., Pohl, F. M., Pohl, T. M., Potier, S., Proft, M., Purnelle, B., Ramezani Rad, M., Rieger, M., Rose, M., Schaaff-Gerstenschlager, I., Scherens, B., Schwarzlose, C., Skala, J., Slonimski, P. P., Smits, P. H., Souciet, J. L., Steensma, H. Y., Stucka, R., Urrestarazu, A., van der Aart, Q. J., van Dyck, L., Vassarotti, A., Vetter, I., Vierendeels, F., Vissers, S., Wagner, G., de Wergifosse, P., Wolfe, K. H., Zagulski, M., Zimmermann, F. K., Mewes, H. W., Kleine, K. (1994). "Complete DNA sequence of yeast chromosome II." EMBO J 13:5795-5809.7813418
  • Nagahashi, S., Sudoh, M., Ono, N., Sawada, R., Yamaguchi, E., Uchida, Y., Mio, T., Takagi, M., Arisawa, M., Yamada-Okabe, H. (1995). "Characterization of chitin synthase 2 of Saccharomyces cerevisiae. Implication of two highly conserved domains as possible catalytic sites." J Biol Chem 270:13961-13967.7775457
  • Ficarro, S. B., McCleland, M. L., Stukenberg, P. T., Burke, D. J., Ross, M. M., Shabanowitz, J., Hunt, D. F., White, F. M. (2002). "Phosphoproteome analysis by mass spectrometry and its application to Saccharomyces cerevisiae." Nat Biotechnol 20:301-305.11875433
  • Kim, H., Melen, K., Osterberg, M., von Heijne, G. (2006). "A global topology map of the Saccharomyces cerevisiae membrane proteome." Proc Natl Acad Sci U S A 103:11142-11147.16847258
  • Chi, A., Huttenhower, C., Geer, L. Y., Coon, J. J., Syka, J. E., Bai, D. L., Shabanowitz, J., Burke, D. J., Troyanskaya, O. G., Hunt, D. F. (2007). "Analysis of phosphorylation sites on proteins from Saccharomyces cerevisiae by electron transfer dissociation (ETD) mass spectrometry." Proc Natl Acad Sci U S A 104:2193-2198.17287358
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956