You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameCalcium-transporting ATPase 1
Synonyms
  • Bypass SOD defects protein 1
  • Golgi Ca(2+)-ATPase
Gene NamePMR1
Enzyme Class
Biological Properties
General FunctionInvolved in nucleotide binding
Specific FunctionThis magnesium-dependent enzyme catalyzes the hydrolysis of ATP coupled with the transport of calcium. Has a role in the secretory pathway
Cellular LocationGolgi apparatus membrane; Multi-pass membrane protein
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00109Adenosine triphosphateShow
YMDB00358Calcium(2+)Show
YMDB00890waterShow
YMDB00907phosphateShow
YMDB00914ADPShow
GO Classification
Component
cell part
membrane
membrane part
intrinsic to membrane
integral to membrane
Function
calcium ion transmembrane transporter activity
calcium-transporting ATPase activity
hydrolase activity
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
ATPase activity, coupled to transmembrane movement of ions
ATPase activity, coupled to transmembrane movement of ions, phosphorylative mechanism
binding
hydrolase activity, acting on acid anhydrides
hydrolase activity, acting on acid anhydrides, catalyzing transmembrane movement of substances
catalytic activity
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
ATP binding
cation transmembrane transporter activity
transporter activity
inorganic cation transmembrane transporter activity
transmembrane transporter activity
di-, tri-valent inorganic cation transmembrane transporter activity
Process
cellular nitrogen compound metabolic process
transport
nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
di-, tri-valent inorganic cation transport
nucleobase, nucleoside and nucleotide metabolic process
divalent metal ion transport
nucleoside phosphate metabolic process
calcium ion transport
nucleotide metabolic process
ion transport
purine nucleotide metabolic process
purine nucleotide biosynthetic process
cation transport
metabolic process
purine nucleoside triphosphate biosynthetic process
purine ribonucleoside triphosphate biosynthetic process
ATP biosynthetic process
nitrogen compound metabolic process
establishment of localization
Gene Properties
Chromosome Locationchromosome 7
LocusYGL167C
Gene Sequence>2853 bp ATGAGTGACAATCCATTTAATGCGAGTCTTCTTGACGAGGACTCAAACCGTGAGAGAGAA ATACTAGATGCCACAGCAGAGGCCCTTTCGAAACCAAGCCCTTCTTTAGAGTATTGTACT TTATCCGTGGACGAAGCTCTAGAAAAACTGGACACTGACAAAAACGGTGGTTTACGATCA TCTAACGAGGCCAACAATAGGAGATCACTTTATGGCCCCAATGAAATAACCGTAGAAGAT GATGAAAGTCTTTTCAAGAAGTTCTTGTCAAATTTCATTGAGGATCGAATGATTCTACTT TTAATAGGATCCGCAGTGGTCTCTCTTTTTATGGGTAACATTGATGATGCTGTTAGTATC ACACTGGCCATTTTCATAGTTGTCACTGTCGGTTTTGTCCAAGAATATAGGTCTGAAAAA TCTCTAGAAGCGTTGAATAAATTGGTTCCTGCTGAATGTCACTTAATGAGATGTGGTCAA GAGAGTCATGTACTGGCTTCCACCTTGGTTCCTGGTGATTTAGTGCACTTCAGAATAGGT GACAGAATCCCCGCAGACATTAGAATTATTGAAGCAATCGATTTATCCATCGATGAAAGT AATTTAACTGGTGAAAATGAACCGGTACATAAAACCTCACAAACGATCGAAAAATCTTCC TTTAACGATCAGCCTAATTCAATTGTACCGATTTCTGAGAGATCTTGTATAGCTTATATG GGTACATTAGTCAAGGAAGGTCATGGTAAGGGTATCGTCGTAGGAACAGGTACAAACACA TCCTTTGGTGCCGTTTTTGAAATGATGAATAATATTGAAAAACCGAAGACTCCATTGCAG TTAACAATGGACAAATTGGGAAAGGACTTGTCACTGGTTAGCTTCATAGTTATTGGTATG ATTTGTTTAGTTGGTATCATACAAGGTAGATCTTGGTTAGAAATGTTCCAAATATCGGTA TCCTTAGCGGTTGCTGCTATTCCAGAAGGGTTACCAATTATTGTCACTGTTACTTTGGCA TTGGGTGTTCTGAGAATGGCCAAGCGTAAAGCCATCGTGAGAAGGTTACCAAGTGTCGAA ACTTTAGGCTCTGTCAACGTTATCTGCTCCGACAAAACAGGTACACTAACCTCAAACCAC ATGACCGTATCTAAACTTTGGTGCTTGGACAGTATGTCCAATAAGCTAAACGTCCTCTCA TTAGACAAAAATAAGAAGACTAAAAATTCTAATGGAAATTTGAAAAACTATTTGACTGAA GACGTTAGGGAAACTCTAACTATCGGTAATCTCTGTAATAATGCATCTTTCTCTCAAGAA CATGCCATATTTCTGGGAAATCCTACTGATGTAGCTCTTTTAGAGCAATTGGCAAACTTT GAAATGCCTGATATCAGAAACACCGTTCAAAAAGTTCAGGAACTTCCATTTAACTCGAAA AGAAAATTAATGGCAACCAAGATTCTCAACCCTGTCGACAATAAGTGTACAGTTTATGTT AAAGGTGCATTTGAAAGAATTCTTGAGTACTCCACAAGTTATTTGAAATCAAAGGGTAAA AAAACTGAAAAGTTGACTGAAGCCCAAAAAGCTACGATAAATGAGTGCGCAAATTCTATG GCATCTGAAGGTTTGCGTGTCTTTGGATTTGCTAAACTAACTTTGTCTGATTCATCAACT CCTCTAACCGAAGACCTAATCAAAGATTTAACCTTTACTGGTTTAATCGGTATGAATGAC CCACCAAGACCGAACGTTAAATTTGCCATCGAACAATTACTACAAGGTGGTGTCCATATT ATTATGATCACTGGTGATTCTGAGAATACCGCAGTAAACATTGCAAAACAAATTGGTATT CCAGTTATTGATCCAAAGCTTTCCGTTTTATCCGGTGATAAATTAGATGAAATGTCAGAT GATCAACTGGCCAATGTCATCGACCACGTTAATATTTTTGCTCGTGCTACGCCTGAGCAT AAGTTAAACATTGTTCGTGCATTAAGAAAGAGGGGTGATGTGGTAGCAATGACTGGTGAT GGTGTTAACGACGCTCCTGCGTTGAAACTTTCAGATATTGGTGTTTCTATGGGTAGAATT GGTACAGATGTAGCCAAAGAAGCCTCAGATATGGTCTTAACTGATGATGACTTCAGTACT ATTTTAACTGCCATTGAAGAGGGTAAAGGTATCTTTAATAATATTCAGAATTTCCTGACT TTTCAATTGTCTACTTCTGTTGCCGCACTATCATTAGTTGCACTATCTACAGCGTTTAAA CTACCCAATCCACTGAACGCAATGCAAATTCTTTGGATAAATATTTTAATGGATGGGCCA CCAGCTCAATCCTTAGGTGTGGAACCTGTTGATCATGAAGTTATGAAAAAACCTCCAAGA AAACGTACCGATAAAATTTTGACCCATGATGTAATGAAACGTTTACTAACCACCGCGGCC TGTATCATCGTTGGGACAGTTTACATTTTTGTTAAAGAGATGGCCGAAGATGGTAAAGTA ACTGCTAGAGATACTACTATGACATTTACTTGTTTTGTTTTTTTTGATATGTTTAATGCT TTGGCCTGCAGACATAACACAAAGTCAATCTTCGAAATCGGCTTTTTCACGAACAAAATG TTCAACTACGCCGTTGGACTGTCTCTGTTAGGTCAAATGTGCGCTATATATATACCATTT TTCCAAAGTATCTTTAAAACTGAGAAACTTGGTATCTCTGATATACTATTGTTATTGCTC ATCAGCAGTAGCGTTTTCATCGTTGATGAATTGAGAAAATTGTGGACGAGGAAAAAGAAT GAAGAAGACTCAACGTATTTCTCAAATGTTTGA
Protein Properties
Pfam Domain Function
Protein Residues950
Protein Molecular Weight104570.0
Protein Theoretical pI5.36
Signalling Regions
  • None
Transmembrane Regions
  • 93-111
  • 117-133
  • 289-309
  • 324-344
  • 815-835
  • 845-862
  • 885-905
  • 910-930
Protein Sequence>Calcium-transporting ATPase 1 MSDNPFNASLLDEDSNREREILDATAEALSKPSPSLEYCTLSVDEALEKLDTDKNGGLRS SNEANNRRSLYGPNEITVEDDESLFKKFLSNFIEDRMILLLIGSAVVSLFMGNIDDAVSI TLAIFIVVTVGFVQEYRSEKSLEALNKLVPAECHLMRCGQESHVLASTLVPGDLVHFRIG DRIPADIRIIEAIDLSIDESNLTGENEPVHKTSQTIEKSSFNDQPNSIVPISERSCIAYM GTLVKEGHGKGIVVGTGTNTSFGAVFEMMNNIEKPKTPLQLTMDKLGKDLSLVSFIVIGM ICLVGIIQGRSWLEMFQISVSLAVAAIPEGLPIIVTVTLALGVLRMAKRKAIVRRLPSVE TLGSVNVICSDKTGTLTSNHMTVSKLWCLDSMSNKLNVLSLDKNKKTKNSNGNLKNYLTE DVRETLTIGNLCNNASFSQEHAIFLGNPTDVALLEQLANFEMPDIRNTVQKVQELPFNSK RKLMATKILNPVDNKCTVYVKGAFERILEYSTSYLKSKGKKTEKLTEAQKATINECANSM ASEGLRVFGFAKLTLSDSSTPLTEDLIKDLTFTGLIGMNDPPRPNVKFAIEQLLQGGVHI IMITGDSENTAVNIAKQIGIPVIDPKLSVLSGDKLDEMSDDQLANVIDHVNIFARATPEH KLNIVRALRKRGDVVAMTGDGVNDAPALKLSDIGVSMGRIGTDVAKEASDMVLTDDDFST ILTAIEEGKGIFNNIQNFLTFQLSTSVAALSLVALSTAFKLPNPLNAMQILWINILMDGP PAQSLGVEPVDHEVMKKPPRKRTDKILTHDVMKRLLTTAACIIVGTVYIFVKEMAEDGKV TARDTTMTFTCFVFFDMFNALACRHNTKSIFEIGFFTNKMFNYAVGLSLLGQMCAIYIPF FQSIFKTEKLGISDILLLLLISSSVFIVDELRKLWTRKKNEEDSTYFSNV
References
External Links
ResourceLink
Saccharomyces Genome Database PMR1
Uniprot IDP13586
Uniprot NameATC1_YEAST
GenBank Gene IDM25488
Genebank Protein ID172199
General Reference
  • Rudolph, H. K., Antebi, A., Fink, G. R., Buckley, C. M., Dorman, T. E., LeVitre, J., Davidow, L. S., Mao, J. I., Moir, D. T. (1989). "The yeast secretory pathway is perturbed by mutations in PMR1, a member of a Ca2+ ATPase family." Cell 58:133-145.2526682
  • Klima, R., Coglievina, M., Zaccaria, P., Bertani, I., Bruschi, C. V. (1996). "A putative helicase, the SUA5, PMR1, tRNALys1 genes and four open reading frames have been detected in the DNA sequence of an 8.8 kb fragment of the left arm of chromosome VII of Saccharomyces cerevisiae." Yeast 12:1033-1040.8896267
  • Tettelin, H., Agostoni Carbone, M. L., Albermann, K., Albers, M., Arroyo, J., Backes, U., Barreiros, T., Bertani, I., Bjourson, A. J., Bruckner, M., Bruschi, C. V., Carignani, G., Castagnoli, L., Cerdan, E., Clemente, M. L., Coblenz, A., Coglievina, M., Coissac, E., Defoor, E., Del Bino, S., Delius, H., Delneri, D., de Wergifosse, P., Dujon, B., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome VII." Nature 387:81-84.9169869
  • Na, J. G., Pinto, I., Hampsey, M. (1992). "Isolation and characterization of SUA5, a novel gene required for normal growth in Saccharomyces cerevisiae." Genetics 131:791-801.1325384
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Kim, H., Melen, K., Osterberg, M., von Heijne, G. (2006). "A global topology map of the Saccharomyces cerevisiae membrane proteome." Proc Natl Acad Sci U S A 103:11142-11147.16847258