You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameAlpha-factor-transporting ATPase
Synonyms
  • Mating factor A secretion protein STE6
  • Multiple drug resistance protein homolog
  • P-glycoprotein
Gene NameSTE6
Enzyme Class
Biological Properties
General FunctionInvolved in ATP binding
Specific FunctionSTE6 is required in yeast MATA cells for production of A-factor pheromone. STE6 is involved in the transport of the farnesyl-derivation of the A-factor pheromone
Cellular LocationMembrane; Multi-pass membrane protein
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00109Adenosine triphosphateShow
YMDB00907phosphateShow
YMDB00914ADPShow
GO Classification
Component
integral to membrane
cell part
membrane part
intrinsic to membrane
Function
hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides
binding
primary active transmembrane transporter activity
nucleoside binding
P-P-bond-hydrolysis-driven transmembrane transporter activity
purine nucleoside binding
ATPase activity, coupled to transmembrane movement of substances
adenyl nucleotide binding
pyrophosphatase activity
adenyl ribonucleotide binding
nucleoside-triphosphatase activity
ATP binding
ATPase activity
nucleotide binding
transporter activity
transmembrane transporter activity
active transmembrane transporter activity
catalytic activity
hydrolase activity
hydrolase activity, acting on acid anhydrides
Process
transmembrane transport
establishment of localization
transport
Gene Properties
Chromosome Locationchromosome 11
LocusYKL209C
Gene Sequence>3873 bp ATGAACTTTTTAAGTTTTAAGACTACAAAACACTATCACATTTTCAGGTACGTGAACATA CGGAATGACTACAGGCTGTTAATGATAATGATAATAGGTACCGTGGCAACAGGCCTAGTG CCGGCAATTACTTCTATCCTGACGGGCAGAGTGTTCGATCTACTATCAGTTTTCGTGGCT AATGGGTCACATCAAGGTTTGTATTCCCAACTAGTACAGAGGTCAATGGCAGTAATGGCA CTTGGTGCGGCTTCTGTGCCAGTAATGTGGCTTTCTCTAACAAGTTGGATGCACATCGGC GAGAGACAAGGCTTTAGAATACGGTCACAGATATTGGAGGCATATTTGGAGGAAAAGCCA ATGGAATGGTACGACAATAATGAAAAATTGTTAGGAGATTTTACTCAAATCAACAGATGT GTGGAAGAGCTAAGATCAAGCTCCGCAGAGGCATCAGCCATAACTTTCCAGAATTTAGTT GCAATATGTGCGCTTCTGGGGACGTCATTCTACTATTCTTGGTCATTAACTTTAATTATT CTTTGCAGCTCTCCAATAATCACATTTTTTGCAGTGGTGTTTTCCAGAATGATTCATGTA TATTCAGAGAAGGAGAATTCTGAAACGAGTAAAGCAGCCCAATTACTTACATGGTCGATG AATGCCGCTCAATTAGTGAGATTATATTGTACACAACGTCTAGAAAGGAAAAAATTCAAG GAAATCATACTAAATTGTAACACTTTCTTCATCAAGAGTTGCTTTTTTGTTGCTGCAAAC GCTGGGATCTTGAGATTTTTGACGTTGACTATGTTTGTACAGGGATTCTGGTTTGGTTCC GCAATGATCAAAAAGGGCAAGCTGAACATTAACGATGTAATCACTTGCTTCCATTCATGC ATTATGCTGGGCTCGACTTTAAATAATACATTACACCAAATAGTTGTTCTTCAAAAAGGC GGAGTGGCTATGGAAAAAATCATGACTCTATTAAAAGATGGATCCAAGCGAAATCCTTTA AATAAAACTGTAGCCCACCAATTTCCACTAGATTATGCCACCAGTGATCTAACATTTGCT AATGTTTCGTTTTCTTATCCAAGCAGACCTTCGGAAGCAGTTTTAAAGAACGTTAGTTTA AATTTCTCTGCAGGACAATTTACTTTCATAGTAGGAAAATCAGGCTCAGGTAAATCTACA TTATCCAACTTATTATTAAGGTTCTACGATGGCTATAATGGATCGATATCTATCAATGGC CACAATATCCAAACAATCGACCAAAAATTGCTAATTGAAAATATCACCGTCGTAGAACAG CGTTGTACCCTATTTAATGATACTCTTAGAAAAAATATTCTTTTAGGTTCAACAGATTCG GTAAGAAATGCCGATTGCAGCACCAATGAAAATAGACATTTAATCAAAGATGCCTGTCAA ATGGCTCTTCTGGATAGATTTATTCTAGACCTTCCCGATGGACTGGAAACATTAATTGGG ACTGGGGGTGTCACACTAAGTGGCGGGCAACAACAAAGAGTTGCTATAGCACGTGCATTC ATCAGAGATACTCCAATATTATTCTTAGACGAAGCTGTATCGGCTCTAGATATTGTTCAT CGCAACCTGTTGATGAAGGCAATTAGGCATTGGAGGAAAGGAAAGACTACAATCATATTG ACGCATGAGTTGAGCCAAATTGAATCTGATGACTATTTATATTTAATGAAGGAAGGTGAA GTTGTTGAAAGCGGCACCCAGTCTGAACTTCTAGCCGATCCGACCACTACATTTAGCACA TGGTATCACCTACAGAATGACTACTCTGATGCGAAAACTATTGTAGATACAGAGACTGAA GAAAAATCTATACACACTGTGGAAAGTTTTAACTCTCAATTGGAAACACCAAAACTTGGA TCATGCTTAAGTAATCTGGGATATGATGAGACAGATCAGTTGTCCTTTTACGAAGCAATC TATCAAAAAAGATCGAACGTTAGAACAAGAAGGGTTAAAGTTGAAGAGGAAAATATTGGG TATGCACTAAAACAACAAAAGAACACCGAAAGTTCAACAGGGCCACAACTTCTGAGCATT ATTCAGATTATCAAAAGAATGATTAAAAGCATAAGATACAAAAAAATTCTAATCTTGGGA CTGCTATGTTCTCTTATCGCAGGCGCCACAAATCCCGTCTTTTCATACACATTCAGTTTC TTACTAGAAGGAATTGTCCCATCCACGGATGGAAAAACTGGCTCTTCACATTATTTGGCG AAATGGTCGCTTCTTGTTCTTGGTGTGGCTGCGGCAGATGGTATTTTCAATTTTGCTAAA GGATTCCTATTAGATTGCTGCAGTGAATACTGGGTTATGGATCTTAGAAATGAAGTTATG GAAAAACTGACGAGAAAGAATATGGACTGGTTTTCTGGTGAAAACAACAAGGCTTCTGAA ATTTCTGCTCTAGTCTTGAATGATTTGCGAGATTTGAGGTCTTTGGTCTCTGAATTTTTG AGTGCAATGACTAGTTTCGTTACCGTATCAACGATTGGACTAATTTGGGCGTTAGTATCG GGCTGGAAGTTAAGTTTGGTTTGTATTTCGATGTTTCCACTCATAATTATATTTTCAGCA ATATATGGAGGCATTTTACAAAAATGCGAAACAGATTATAAGACATCTGTTGCTCAGTTA GAAAACTGCCTGTACCAGATTGTCACTAACATTAAAACCATTAAGTGCTTACAAGCTGAA TTTCATTTTCAATTGACCTACCATGACTTGAAGATAAAAATGCAACAAATTGCCTCCAAA CGCGCCATTGCCACAGGATTTGGTATATCTATGACAAACATGATTGTCATGTGTATCCAA GCTATTATTTACTACTATGGCCTAAAGCTGGTTATGATTCACGAGTACACCTCAAAGGAA ATGTTTACGACTTTCACTTTGTTATTATTCACTATTATGTCATGCACTAGCCTAGTAAGT CAGATACCCGATATAAGTAGAGGCCAACGTGCTGCCAGTTGGATCTATAGGATTCTTGAT GAAAAGCATAATACCCTAGAGGTTGAAAACAATAATGCTAGAACAGTGGGAATAGCTGGT CACACCTACCATGGCAAAGAAAAAAAACCAATCGTTTCAATTCAAAATTTGACATTTGCC TATCCATCTGCACCTACCGCCTTTGTTTACAAAAACATGAATTTTGACATGTTTTGCGGA CAGACGTTAGGTATCATTGGTGAATCAGGCACAGGAAAGTCTACACTTGTGCTTTTATTA ACAAAACTTTATAATTGTGAAGTAGGCAAAATTAAAATAGACGGTACGGACGTAAATGAC TGGAATTTGACAAGTTTAAGAAAAGAAATTTCAGTGGTTGAGCAAAAACCTTTATTATTC AATGGAACCATCAGAGATAACCTAACTTATGGTTTACAAGATGAAATACTTGAAATTGAA ATGTATGATGCATTAAAATACGTAGGAATCCATGACTTTGTAATTTCATCACCTCAGGGC TTGGATACACGTATTGATACAACTTTACTGTCTGGTGGACAAGCGCAAAGGCTTTGCATA GCCAGAGCACTTCTGAGAAAATCAAAAATTCTGATTTTAGATGAGTGTACTTCAGCCTTG GATTCTGTCAGCTCCTCTATCATCAATGAGATCGTCAAAAAAGGTCCACCTGCTCTACTA ACAATGGTTATAACGCATAGTGAACAAATGATGAGGTCTTGTAACTCGATTGCAGTTCTT AAAGATGGTAAAGTGGTTGAGCGAGGTAACTTCGACACTTTATATAATAATCGCGGGGAA TTATTCCAAATTGTTTCCAACCAAAGCAGTTAA
Protein Properties
Pfam Domain Function
Protein Residues1290
Protein Molecular Weight144764.0
Protein Theoretical pI8.06
Signalling Regions
  • None
Transmembrane Regions
  • 26-46
  • 76-96
  • 151-171
  • 174-194
  • 263-283
  • 297-317
  • 716-736
  • 764-784
  • 839-859
  • 866-886
  • 946-966
  • 982-1002
Protein Sequence>Alpha-factor-transporting ATPase MNFLSFKTTKHYHIFRYVNIRNDYRLLMIMIIGTVATGLVPAITSILTGRVFDLLSVFVA NGSHQGLYSQLVQRSMAVMALGAASVPVMWLSLTSWMHIGERQGFRIRSQILEAYLEEKP MEWYDNNEKLLGDFTQINRCVEELRSSSAEASAITFQNLVAICALLGTSFYYSWSLTLII LCSSPIITFFAVVFSRMIHVYSEKENSETSKAAQLLTWSMNAAQLVRLYCTQRLERKKFK EIILNCNTFFIKSCFFVAANAGILRFLTLTMFVQGFWFGSAMIKKGKLNINDVITCFHSC IMLGSTLNNTLHQIVVLQKGGVAMEKIMTLLKDGSKRNPLNKTVAHQFPLDYATSDLTFA NVSFSYPSRPSEAVLKNVSLNFSAGQFTFIVGKSGSGKSTLSNLLLRFYDGYNGSISING HNIQTIDQKLLIENITVVEQRCTLFNDTLRKNILLGSTDSVRNADCSTNENRHLIKDACQ MALLDRFILDLPDGLETLIGTGGVTLSGGQQQRVAIARAFIRDTPILFLDEAVSALDIVH RNLLMKAIRHWRKGKTTIILTHELSQIESDDYLYLMKEGEVVESGTQSELLADPTTTFST WYHLQNDYSDAKTIVDTETEEKSIHTVESFNSQLETPKLGSCLSNLGYDETDQLSFYEAI YQKRSNVRTRRVKVEEENIGYALKQQKNTESSTGPQLLSIIQIIKRMIKSIRYKKILILG LLCSLIAGATNPVFSYTFSFLLEGIVPSTDGKTGSSHYLAKWSLLVLGVAAADGIFNFAK GFLLDCCSEYWVMDLRNEVMEKLTRKNMDWFSGENNKASEISALVLNDLRDLRSLVSEFL SAMTSFVTVSTIGLIWALVSGWKLSLVCISMFPLIIIFSAIYGGILQKCETDYKTSVAQL ENCLYQIVTNIKTIKCLQAEFHFQLTYHDLKIKMQQIASKRAIATGFGISMTNMIVMCIQ AIIYYYGLKLVMIHEYTSKEMFTTFTLLLFTIMSCTSLVSQIPDISRGQRAASWIYRILD EKHNTLEVENNNARTVGIAGHTYHGKEKKPIVSIQNLTFAYPSAPTAFVYKNMNFDMFCG QTLGIIGESGTGKSTLVLLLTKLYNCEVGKIKIDGTDVNDWNLTSLRKEISVVEQKPLLF NGTIRDNLTYGLQDEILEIEMYDALKYVGIHDFVISSPQGLDTRIDTTLLSGGQAQRLCI ARALLRKSKILILDECTSALDSVSSSIINEIVKKGPPALLTMVITHSEQMMRSCNSIAVL KDGKVVERGNFDTLYNNRGELFQIVSNQSS
References
External Links
ResourceLink
Saccharomyces Genome Database STE6
Uniprot IDP12866
Uniprot NameSTE6_YEAST
GenBank Gene IDM26376
Genebank Protein ID172758
General Reference
  • McGrath, J. P., Varshavsky, A. (1989). "The yeast STE6 gene encodes a homologue of the mammalian multidrug resistance P-glycoprotein." Nature 340:400-404.2569166
  • Kuchler, K., Sterne, R. E., Thorner, J. (1989). "Saccharomyces cerevisiae STE6 gene product: a novel pathway for protein export in eukaryotic cells." EMBO J 8:3973-3984.2686977
  • Dujon, B., Alexandraki, D., Andre, B., Ansorge, W., Baladron, V., Ballesta, J. P., Banrevi, A., Bolle, P. A., Bolotin-Fukuhara, M., Bossier, P., et, a. l. .. (1994). "Complete DNA sequence of yeast chromosome XI." Nature 369:371-378.8196765
  • Wilson, K. L., Herskowitz, I. (1986). "Sequences upstream of the STE6 gene required for its expression and regulation by the mating type locus in Saccharomyces cerevisiae." Proc Natl Acad Sci U S A 83:2536-2540.3517872
  • Berkower, C., Michaelis, S. (1991). "Mutational analysis of the yeast a-factor transporter STE6, a member of the ATP binding cassette (ABC) protein superfamily." EMBO J 10:3777-3785.1935899
  • Kolling, R., Hollenberg, C. P. (1994). "The ABC-transporter Ste6 accumulates in the plasma membrane in a ubiquitinated form in endocytosis mutants." EMBO J 13:3261-3271.8045256
  • Geller, D., Taglicht, D., Edgar, R., Tam, A., Pines, O., Michaelis, S., Bibi, E. (1996). "Comparative topology studies in Saccharomyces cerevisiae and in Escherichia coli. The N-terminal half of the yeast ABC protein Ste6." J Biol Chem 271:13746-13753.8662764
  • Peng, J., Schwartz, D., Elias, J. E., Thoreen, C. C., Cheng, D., Marsischky, G., Roelofs, J., Finley, D., Gygi, S. P. (2003). "A proteomics approach to understanding protein ubiquitination." Nat Biotechnol 21:921-926.12872131
  • Kim, H., Melen, K., Osterberg, M., von Heijne, G. (2006). "A global topology map of the Saccharomyces cerevisiae membrane proteome." Proc Natl Acad Sci U S A 103:11142-11147.16847258