You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameGlucose-6-phosphate isomerase
Synonyms
  • GPI
  • Phosphoglucose isomerase
  • PGI
  • Phosphohexose isomerase
  • PHI
Gene NamePGI1
Enzyme Class
Biological Properties
General FunctionInvolved in glucose-6-phosphate isomerase activity
Specific FunctionD-glucose 6-phosphate = D-fructose 6- phosphate
Cellular LocationCytoplasm
SMPDB Pathways
Amino sugar and nucleotide sugar metabolismPW002413 ThumbThumb?image type=greyscaleThumb?image type=simple
Fructose MetabolismPW002390 ThumbThumb?image type=greyscaleThumb?image type=simple
Glycolysis IPW002386 ThumbThumb?image type=greyscaleThumb?image type=simple
Starch and sucrose metabolismPW002481 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Amino sugar and nucleotide sugar metabolismec00520 Map00520
Glycolysis / Gluconeogenesisec00010 Map00010
Pentose phosphate pathwayec00030 Map00030
Starch and sucrose metabolismec00500 Map00500
SMPDB Reactions
Fructose 6-phosphateGlucose 6-phosphate
Beta-D-Glucose 6-phosphateFructose 6-phosphate
Glucose 6-phosphateβ-D-fructofuranose 6-phosphate
Fructose 6-phosphateBeta-D-Glucose 6-phosphate
Beta-D-Fructose 6-phosphateGlucose 6-phosphate
KEGG Reactions
aldehydo-D-glucose 6-phosphateBeta-D-Glucose 6-phosphate
Beta-D-Glucose 6-phosphateFructose 6-phosphate
aldehydo-D-glucose 6-phosphateFructose 6-phosphate
Metabolites
YMDB IDNameView
YMDB00078Fructose 6-phosphateShow
YMDB00311Beta-D-Glucose 6-phosphateShow
YMDB00582aldehydo-D-glucose 6-phosphateShow
YMDB00947Glucose 6-phosphateShow
YMDB16176Beta-D-Fructose 6-phosphateShow
YMDB16262β-D-fructofuranose 6-phosphateShow
GO Classification
Component
Not Available
Function
isomerase activity
catalytic activity
intramolecular oxidoreductase activity
intramolecular oxidoreductase activity, interconverting aldoses and ketoses
glucose-6-phosphate isomerase activity
Process
gluconeogenesis
alcohol metabolic process
monosaccharide metabolic process
hexose metabolic process
glucose metabolic process
glucose catabolic process
glycolysis
metabolic process
small molecule metabolic process
Gene Properties
Chromosome Locationchromosome 2
LocusYBR196C
Gene Sequence>1665 bp ATGTCCAATAACTCATTCACTAACTTCAAACTGGCCACTGAATTGCCAGCCTGGTCTAAG TTGCAAAAAATTTATGAATCTCAAGGTAAGACTTTGTCTGTCAAGCAAGAATTCCAAAAA GATGCCAAGCGTTTTGAAAAATTGAACAAGACTTTCACCAACTATGATGGTTCCAAAATC TTGTTCGACTACTCAAAGAACTTGGTCAACGATGAAATCATTGCTGCATTGATTGAACTG GCCAAGGAGGCTAACGTCACCGGTTTGAGAGATGCTATGTTCAAAGGTGAACACATCAAC TCCACTGAAGATCGTGCTGTCTACCACGTCGCATTGAGAAACAGAGCTAACAAGCCAATG TACGTTGATGGTGTCAACGTTGCTCCAGAAGTCGACTCTGTCTTGAAGCACATGAAGGAG TTCTCTGAACAAGTTCGTTCTGGTGAATGGAAGGGTTATACCGGTAAGAAGATCACCGAT GTTGTTAACATCGGTATTGGTGGTTCCGATTTGGGTCCAGTCATGGTCACTGAGGCTTTG AAGCACTACGCTGGTGTCTTGGATGTCCACTTCGTTTCCAACATTGACGGTACTCACATT GCTGAAACCTTGAAGGTTGTTGACCCAGAAACTACTTTGTTTTTGATTGCTTCCAAGACT TTCACTACCGCTGAAACTATCACTAACGCTAACACTGCCAAGAACTGGTTCTTGTCGAAG ACAGGTAATGATCCATCTCACATTGCTAAGCATTTCGCTGCTTTGTCCACTAACGAAACC GAAGTTGCCAAGTTCGGTATTGACACCAAAAACATGTTTGGTTTCGAAAGTTGGGTCGGT GGTCGTTACTCTGTCTGGTCGGCTATTGGTTTGTCTGTTGCCTTGTACATTGGCTATGAC AACTTTGAGGCTTTCTTGAAGGGTGCTGAAGCCGTCGACAACCACTTCACCCAAACCCCA TTGGAAGACAACATTCCATTGTTGGGTGGTTTGTTGTCTGTCTGGTACAACAACTTCTTT GGTGCTCAAACCCATTTGGTTGCTCCATTCGACCAATACTTGCACAGATTCCCAGCCTAC TTGCAACAATTGTCAATGGAATCTAACGGTAAGTCTGTTACCAGAGGTAACGTGTTTACT GACTACTCTACTGGTTCTATCTTGTTTGGTGAACCAGCTACCAACGCTCAACACTCTTTC TTCCAATTGGTTCACCAAGGTACCAAGTTGATTCCATCTGATTTCATCTTAGCTGCTCAA TCTCATAACCCAATTGAGAACAAATTACATCAAAAGATGTTGGCTTCAAACTTCTTTGCT CAAGCTGAAGCTTTAATGGTTGGTAAGGATGAAGAACAAGTTAAGGCTGAAGGTGCCACT GGTGGTTTGGTCCCACACAAGGTCTTCTCAGGTAACAGACCAACTACCTCTATCTTGGCT CAAAAGATTACTCCAGCTACTTTGGGTGCTTTGATTGCCTACTACGAACATGTTACTTTC ACTGAAGGTGCCATTTGGAATATCAACTCTTTCGACCAATGGGGTGTTGAATTGGGTAAA GTCTTGGCTAAAGTCATCGGCAAGGAATTGGACAACTCCTCCACCATTTCTACCCACGAT GCTTCTACCAACGGTTTAATCAATCAATTCAAGGAATGGATGTGA
Protein Properties
Pfam Domain Function
Protein Residues554
Protein Molecular Weight61298.89844
Protein Theoretical pI6.42
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Glucose-6-phosphate isomerase MSNNSFTNFKLATELPAWSKLQKIYESQGKTLSVKQEFQKDAKRFEKLNKTFTNYDGSKI LFDYSKNLVNDEIIAALIELAKEANVTGLRDAMFKGEHINSTEDRAVYHVALRNRANKPM YVDGVNVAPEVDSVLKHMKEFSEQVRSGEWKGYTGKKITDVVNIGIGGSDLGPVMVTEAL KHYAGVLDVHFVSNIDGTHIAETLKVVDPETTLFLIASKTFTTAETITNANTAKNWFLSK TGNDPSHIAKHFAALSTNETEVAKFGIDTKNMFGFESWVGGRYSVWSAIGLSVALYIGYD NFEAFLKGAEAVDNHFTQTPLEDNIPLLGGLLSVWYNNFFGAQTHLVAPFDQYLHRFPAY LQQLSMESNGKSVTRGNVFTDYSTGSILFGEPATNAQHSFFQLVHQGTKLIPSDFILAAQ SHNPIENKLHQKMLASNFFAQAEALMVGKDEEQVKAEGATGGLVPHKVFSGNRPTTSILA QKITPATLGALIAYYEHVTFTEGAIWNINSFDQWGVELGKVLAKVIGKELDNSSTISTHD ASTNGLINQFKEWM
References
External Links
ResourceLink
Saccharomyces Genome Database PGI1
Uniprot IDP12709
Uniprot NameG6PI_YEAST
GenBank Gene IDM21696
Genebank Protein ID172225
General Reference
  • Tekamp-Olson, P., Najarian, R., Burke, R. L. (1988). "The isolation, characterization and nucleotide sequence of the phosphoglucoisomerase gene of Saccharomyces cerevisiae." Gene 73:153-161.3072254
  • Green, J. B., Wright, A. P., Cheung, W. Y., Lancashire, W. E., Hartley, B. S. (1988). "The structure and regulation of phosphoglucose isomerase in Saccharomyces cerevisiae." Mol Gen Genet 215:100-106.3071735
  • Demolis, N., Mallet, L., Bussereau, F., Jacquet, M. (1993). "RIM2, MSI1 and PGI1 are located within an 8 kb segment of Saccharomyces cerevisiae chromosome II, which also contains the putative ribosomal gene L21 and a new putative essential gene with a leucine zipper motif." Yeast 9:645-659.8346681
  • Feldmann, H., Aigle, M., Aljinovic, G., Andre, B., Baclet, M. C., Barthe, C., Baur, A., Becam, A. M., Biteau, N., Boles, E., Brandt, T., Brendel, M., Bruckner, M., Bussereau, F., Christiansen, C., Contreras, R., Crouzet, M., Cziepluch, C., Demolis, N., Delaveau, T., Doignon, F., Domdey, H., Dusterhus, S., Dubois, E., Dujon, B., El Bakkoury, M., Entian, K. D., Feurmann, M., Fiers, W., Fobo, G. M., Fritz, C., Gassenhuber, H., Glandsdorff, N., Goffeau, A., Grivell, L. A., de Haan, M., Hein, C., Herbert, C. J., Hollenberg, C. P., Holmstrom, K., Jacq, C., Jacquet, M., Jauniaux, J. C., Jonniaux, J. L., Kallesoe, T., Kiesau, P., Kirchrath, L., Kotter, P., Korol, S., Liebl, S., Logghe, M., Lohan, A. J., Louis, E. J., Li, Z. Y., Maat, M. J., Mallet, L., Mannhaupt, G., Messenguy, F., Miosga, T., Molemans, F., Muller, S., Nasr, F., Obermaier, B., Perea, J., Pierard, A., Piravandi, E., Pohl, F. M., Pohl, T. M., Potier, S., Proft, M., Purnelle, B., Ramezani Rad, M., Rieger, M., Rose, M., Schaaff-Gerstenschlager, I., Scherens, B., Schwarzlose, C., Skala, J., Slonimski, P. P., Smits, P. H., Souciet, J. L., Steensma, H. Y., Stucka, R., Urrestarazu, A., van der Aart, Q. J., van Dyck, L., Vassarotti, A., Vetter, I., Vierendeels, F., Vissers, S., Wagner, G., de Wergifosse, P., Wolfe, K. H., Zagulski, M., Zimmermann, F. K., Mewes, H. W., Kleine, K. (1994). "Complete DNA sequence of yeast chromosome II." EMBO J 13:5795-5809.7813418
  • Mallet, L., Bussereau, F., Jacquet, M. (1994). "Nucleotide sequence analysis of an 11.7 kb fragment of yeast chromosome II including BEM1, a new gene of the WD-40 repeat family and a new member of the KRE2/MNT1 family." Yeast 10:819-831.7975899
  • Garrels, J. I., McLaughlin, C. S., Warner, J. R., Futcher, B., Latter, G. I., Kobayashi, R., Schwender, B., Volpe, T., Anderson, D. S., Mesquita-Fuentes, R., Payne, W. E. (1997). "Proteome studies of Saccharomyces cerevisiae: identification and characterization of abundant proteins." Electrophoresis 18:1347-1360.9298649
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Gruhler, A., Olsen, J. V., Mohammed, S., Mortensen, P., Faergeman, N. J., Mann, M., Jensen, O. N. (2005). "Quantitative phosphoproteomics applied to the yeast pheromone signaling pathway." Mol Cell Proteomics 4:310-327.15665377
  • Chi, A., Huttenhower, C., Geer, L. Y., Coon, J. J., Syka, J. E., Bai, D. L., Shabanowitz, J., Burke, D. J., Troyanskaya, O. G., Hunt, D. F. (2007). "Analysis of phosphorylation sites on proteins from Saccharomyces cerevisiae by electron transfer dissociation (ETD) mass spectrometry." Proc Natl Acad Sci U S A 104:2193-2198.17287358
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956