You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameInositol-3-phosphate synthase
Synonyms
  • MIP synthase
  • Myo-inositol-1-phosphate synthase
  • IPS
  • MI-1-P synthase
Gene NameINO1
Enzyme Class
Biological Properties
General FunctionInvolved in inositol-3-phosphate synthase activity
Specific FunctionD-glucose 6-phosphate = 1D-myo-inositol 3- phosphate
Cellular LocationCytoplasm
SMPDB Pathways
Inositol phosphate metabolismPW002495 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Inositol phosphate metabolismec00562 Map00562
SMPDB ReactionsNot Available
KEGG Reactions
aldehydo-D-glucose 6-phosphate1D-myo-inositol 1-phosphate
Metabolites
YMDB IDNameView
YMDB00582aldehydo-D-glucose 6-phosphateShow
YMDB007141D-myo-inositol 1-phosphateShow
YMDB007151D-myo-inositol 3-phosphateShow
YMDB00947Glucose 6-phosphateShow
GO Classification
Component
Not Available
Function
isomerase activity
catalytic activity
intramolecular lyase activity
inositol-3-phosphate synthase activity
binding
Process
alcohol metabolic process
polyol metabolic process
organophosphate metabolic process
phospholipid metabolic process
phospholipid biosynthetic process
metabolic process
inositol metabolic process
inositol biosynthetic process
small molecule metabolic process
Gene Properties
Chromosome Locationchromosome 10
LocusYJL153C
Gene Sequence>YJL153C INO1 SGDID:S000003689, Chr X from 135933-134332, reverse complement, Verified ORF, "Inositol-3-phosphate synthase, involved in synthesis of inositol phosphates and inositol-containing phospholipids; transcription is coregulated with other phosphol ATGACAGAAGATAATATTGCTCCAATCACCTCCGTTAAAGTAGTTACCGACAAGTGCACG TACAAGGACAACGAGCTGCTCACCAAGTACAGCTACGAAAATGCTGTAGTTACGAAGACA GCTAGTGGCCGCTTCGATGTAACGCCCACTGTTCAAGACTACGTGTTCAAACTTGACTTG AAAAAGCCGGAAAAACTAGGAATTATGCTCATTGGGTTAGGTGGCAACAATGGCTCCACT TTAGTGGCCTCGGTATTGGCGAATAAGCACAATGTGGAGTTTCAAACTAAGGAAGGCGTT AAGCAACCAAACTACTTCGGCTCCATGACTCAATGTTCTACCTTGAAACTGGGTATCGAT GCGGAGGGGAATGACGTTTATGCTCCTTTTAACTCTCTGTTGCCCATGGTTAGCCCAAAC GACTTTGTCGTCTCTGGTTGGGACATCAATAACGCAGATCTATACGAAGCTATGCAGAGA AGTCAAGTTCTCGAATATGATCTGCAACAACGCTTGAAGGCGAAGATGTCCTTGGTGAAG CCTCTTCCTTCCATTTACTACCCTGATTTCATTGCAGCTAATCAAGATGAGAGAGCCAAT AACTGCATCAATTTGGATGAAAAAGGCAACGTAACCACGAGGGGTAAGTGGACCCATCTG CAACGCATCAGACGCGATATCCAGAATTTCAAAGAAGAAAACGCCCTTGATAAAGTAATC GTTCTTTGGACTGCAAATACTGAGAGGTACGTAGAAGTATCTCCTGGTGTTAATGACACC ATGGAAAACCTCTTGCAGTCTATTAAGAATGACCATGAAGAGATTGCTCCTTCCACGATC TTTGCAGCAGCATCTATCTTGGAAGGTGTCCCCTATATTAATGGTTCACCGCAGAATACT TTTGTTCCCGGCTTGGTTCAGCTGGCTGAGCATGAGGGTACATTCATTGCGGGAGACGAT CTCAAGTCGGGACAAACCAAGTTGAAGTCTGTTCTGGCCCAGTTCTTAGTGGATGCAGGT ATTAAACCGGTCTCCATTGCATCCTATAACCATTTAGGCAATAATGACGGTTATAACTTA TCTGCTCCAAAACAATTTAGGTCTAAGGAGATTTCCAAAAGTTCTGTCATAGATGACATC ATCGCGTCTAATGATATCTTGTACAATGATAAACTGGGTAAAAAAGTTGACCACTGCATT GTCATCAAATATATGAAGCCCGTCGGGGACTCAAAAGTGGCAATGGACGAGTATTACAGT GAGTTGATGTTAGGTGGCCATAACCGGATTTCCATTCACAATGTTTGCGAAGATTCTTTA CTGGCTACGCCCTTGATCATCGATCTTTTAGTCATGACTGAGTTTTGTACAAGAGTGTCC TATAAGAAGGTGGACCCAGTTAAAGAAGATGCTGGCAAATTCGAGAACTTTTATCCAGTT TTAACCTTCTTGAGTTACTGGTTAAAAGCTCCATTAACAAGACCAGGATTTCACCCGGTG AATGGCTTAAACAAGCAAAGAACCGCCTTAGAAAATTTTTTAAGATTGTTGATTGGATTG CCTTCTCAAAACGAACTAAGATTCGAAGAGAGATTGTTGTAA
Protein Properties
Pfam Domain Function
Protein Residues533
Protein Molecular Weight59641.60156
Protein Theoretical pI5.71
PDB Fileshow
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Inositol-3-phosphate synthase MTEDNIAPITSVKVVTDKCTYKDNELLTKYSYENAVVTKTASGRFDVTPTVQDYVFKLDL KKPEKLGIMLIGLGGNNGSTLVASVLANKHNVEFQTKEGVKQPNYFGSMTQCSTLKLGID AEGNDVYAPFNSLLPMVSPNDFVVSGWDINNADLYEAMQRSQVLEYDLQQRLKAKMSLVK PLPSIYYPDFIAANQDERANNCINLDEKGNVTTRGKWTHLQRIRRDIQNFKEENALDKVI VLWTANTERYVEVSPGVNDTMENLLQSIKNDHEEIAPSTIFAAASILEGVPYINGSPQNT FVPGLVQLAEHEGTFIAGDDLKSGQTKLKSVLAQFLVDAGIKPVSIASYNHLGNNDGYNL SAPKQFRSKEISKSSVIDDIIASNDILYNDKLGKKVDHCIVIKYMKPVGDSKVAMDEYYS ELMLGGHNRISIHNVCEDSLLATPLIIDLLVMTEFCTRVSYKKVDPVKEDAGKFENFYPV LTFLSYWLKAPLTRPGFHPVNGLNKQRTALENFLRLLIGLPSQNELRFEERLL
References
External Links
ResourceLink
Saccharomyces Genome Database INO1
Uniprot IDP11986
Uniprot NameINO1_YEAST
PDB ID
1RM0
General Reference
  • Dean-Johnson, M., Henry, S. A. (1989). "Biosynthesis of inositol in yeast. Primary structure of myo-inositol-1-phosphate synthase (EC 5.5.1.4) and functional analysis of its structural gene, the INO1 locus." J Biol Chem 264:1274-1283.2642902
  • Klig, L. S., Zobel, P. A., Devry, C. G., Losberger, C. (1994). "Comparison of INO1 gene sequences and products in Candida albicans and Saccharomyces cerevisiae." Yeast 10:789-800.7975896
  • Katsoulou, C., Tzermia, M., Tavernarakis, N., Alexandraki, D. (1996). "Sequence analysis of a 40.7 kb segment from the left arm of yeast chromosome X reveals 14 known genes and 13 new open reading frames including homologues of genes clustered on the right arm of chromosome XI." Yeast 12:787-797.8813765
  • Galibert, F., Alexandraki, D., Baur, A., Boles, E., Chalwatzis, N., Chuat, J. C., Coster, F., Cziepluch, C., De Haan, M., Domdey, H., Durand, P., Entian, K. D., Gatius, M., Goffeau, A., Grivell, L. A., Hennemann, A., Herbert, C. J., Heumann, K., Hilger, F., Hollenberg, C. P., Huang, M. E., Jacq, C., Jauniaux, J. C., Katsoulou, C., Karpfinger-Hartl, L., et, a. l. .. (1996). "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome X." EMBO J 15:2031-2049.8641269
  • Stein, A. J., Geiger, J. H. (2002). "The crystal structure and mechanism of 1-L-myo-inositol- 1-phosphate synthase." J Biol Chem 277:9484-9491.11779862