You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification |
---|
Name | Pheromone receptor transcription factor |
---|
Synonyms | |
---|
Gene Name | MCM1 |
---|
Enzyme Class | Not Available |
---|
Biological Properties |
---|
General Function | regulation of mating type switching |
---|
Specific Function | Transcription factor required for the efficient replication of minichromosomes and the transcriptional regulation of early cell cycle genes. Activates transcription of ECB-dependent genes during the G1/M phase. Genes that contain a ECB (early cell box) element in their transcription regulatory region are transcribed only during G1/M phases. Interacts with the alpha-2 repressor or with the alpha-1 activator thereby regulating the expression of mating-type-specific genes. With ARG80, ARG81 and ARG82, coordinates the expression of arginine anabolic and catabolic genes in response to arginine. |
---|
Cellular Location | Not Available |
---|
SMPDB Pathways | Stress-activated signalling pathways: high osmolarity test 1 | PW002773 | | Stress-activated signalling pathways: pheromone stress test 1 | PW012843 | |
|
---|
KEGG Pathways | Not Available |
---|
SMPDB Reactions | Not Available |
---|
KEGG Reactions | Not Available |
---|
Metabolites | |
---|
GO Classification | Function |
---|
negative regulation of mating-type specific transcription from RNA polymerase II promoter | negative regulation of transcription from RNA polymerase II promoter | cytosol | positive regulation of arginine biosynthetic process by positive regulation of transcription from RNA polymerase II promoter | nucleus | positive regulation of mating-type specific transcription from RNA polymerase II promoter | positive regulation of transcription from RNA polymerase II promoter | positive regulation of transcription involved in G2/M transition of mitotic cell cycle | nuclear chromatin | regulation of mating type switching | DNA replication origin binding | RNA polymerase II activating transcription factor binding | RNA polymerase II core promoter proximal region sequence-specific DNA binding | RNA polymerase II core promoter proximal region sequence-specific DNA binding, bending | RNA polymerase II repressing transcription factor binding | RNA polymerase II transcription factor activity, sequence-specific transcription regulatory region DNA binding | transcriptional activator activity, RNA polymerase II core promoter proximal region sequence-specific binding | transcriptional repressor activity, RNA polymerase II core promoter proximal region sequence-specific binding | arginine metabolic process | DNA replication initiation | negative regulation of arginine catabolic process by negative regulation of transcription from RNA polymerase II promoter |
|
---|
Gene Properties |
---|
Chromosome Location | Not Available |
---|
Locus | |
---|
Gene Sequence | >861 bp
ATGTCAGACATCGAAGAAGGTACGCCTACTAATAATGGGCAACAGAAGGAGAGAAGAAAG
ATAGAAATTAAGTTCATCGAGAATAAAACAAGGCGCCATGTGACATTTTCCAAAAGGAAG
CACGGTATCATGAAAAAGGCGTTTGAGCTTTCTGTTCTAACGGGGACCCAGGTCCTGTTG
CTAGTCGTTTCAGAAACAGGTTTGGTATATACTTTCAGCACGCCGAAGTTTGAACCTATA
GTCACGCAGCAGGAAGGTAGAAACCTGATCCAGGCCTGTCTTAACGCCCCTGATGATGAG
GAAGAAGACGAGGAGGAAGACGGTGATGATGATGATGATGATGACGATGATGGTAATGAT
ATGCAACGCCAGCAACCACAACAACAGCAACCGCAACAACAGCAACAAGTATTGAATGCA
CACGCAAATAGCTTAGGCCATCTAAATCAAGATCAGGTACCGGCAGGCGCGCTGAAACAA
GAGGTGAAGTCACAATTGCTAGGCGGTGCCAATCCTAATCAAAACTCAATGATTCAACAG
CAGCAACATCACACGCAGAATTCACAACCACAACAGCAACAGCAACAACAACCACAGCAG
CAAATGTCACAGCAACAAATGTCACAGCATCCTCGACCACAGCAAGGAATACCACATCCG
CAACAATCGCAGCCACAGCAACAGCAACAACAACAACAACAACTGCAACAGCAGCAACAG
CAGCAACAACAACAACCCCTCACCGGCATTCATCAGCCTCACCAACAGGCTTTTGCCAAC
GCTGCCTCCCCCTATCTGAATGCTGAACAGAATGCTGCCTACCAACAATACTTTCAAGAA
CCGCAACAAGGCCAATACTAA |
---|
Protein Properties |
---|
Pfam Domain Function | Not Available |
---|
Protein Residues | 286 |
---|
Protein Molecular Weight | 32801.685 |
---|
Protein Theoretical pI | Not Available |
---|
PDB File | show |
---|
Signalling Regions | Not Available |
---|
Transmembrane Regions | Not Available |
---|
Protein Sequence | >Pheromone receptor transcription factor
MSDIEEGTPTNNGQQKERRKIEIKFIENKTRRHVTFSKRKHGIMKKAFELSVLTGTQVLL
LVVSETGLVYTFSTPKFEPIVTQQEGRNLIQACLNAPDDEEEDEEEDGDDDDDDDDDGND
MQRQQPQQQQPQQQQQVLNAHANSLGHLNQDQVPAGALKQEVKSQLLGGANPNQNSMIQQ
QQHHTQNSQPQQQQQQQPQQQMSQQQMSQHPRPQQGIPHPQQSQPQQQQQQQQQLQQQQQ
QQQQQPLTGIHQPHQQAFANAASPYLNAEQNAAYQQYFQEPQQGQY |
---|
References |
---|
External Links | Resource | Link |
---|
Saccharomyces Genome Database | MCM1 | Uniprot ID | P11746 | Uniprot Name | MCM1 | PDB ID | 1MNM |
|
---|
General Reference | Not Available |
---|