You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameLeucyl-tRNA synthetase, mitochondrial
Synonyms
  • Leucine--tRNA ligase
  • LeuRS
Gene NameNAM2
Enzyme Class
Biological Properties
General FunctionInvolved in nucleotide binding
Specific FunctionATP + L-leucine + tRNA(Leu) = AMP + diphosphate + L-leucyl-tRNA(Leu)
Cellular LocationMitochondrion matrix
SMPDB PathwaysNot Available
KEGG Pathways
Valine, leucine and isoleucine biosynthesisec00290 Map00290
SMPDB ReactionsNot Available
KEGG Reactions
L-Leucine + Adenosine triphosphate + tRNA(Leu) → Adenosine monophosphate + Pyrophosphate + Leu-tRNA(Leu)
Metabolites
YMDB IDNameView
YMDB00097Adenosine monophosphateShow
YMDB00109Adenosine triphosphateShow
YMDB00219PyrophosphateShow
YMDB00387L-LeucineShow
GO Classification
Component
cytoplasm
cell part
intracellular part
Function
nucleoside binding
purine nucleoside binding
leucine-tRNA ligase activity
adenyl nucleotide binding
adenyl ribonucleotide binding
ATP binding
ligase activity, forming carbon-oxygen bonds
ligase activity, forming aminoacyl-tRNA and related compounds
catalytic activity
aminoacyl-tRNA ligase activity
nucleotide binding
ligase activity
binding
Process
macromolecule biosynthetic process
cellular macromolecule biosynthetic process
translation
leucyl-tRNA aminoacylation
metabolic process
macromolecule metabolic process
cellular macromolecule metabolic process
RNA metabolic process
ncRNA metabolic process
tRNA metabolic process
biosynthetic process
tRNA aminoacylation
tRNA aminoacylation for protein translation
Gene Properties
Chromosome Locationchromosome 12
LocusYLR382C
Gene Sequence>2685 bp ATGCTGTCTCGACCTTCAAGCCGATTCCTATCCACTAAAAGGGGCCCTGGACCTGCAGTG AAAAAATTAATTGCAATTGGGGAGAAATGGAAACAGAAGACAACCCGTGGCTTGCCTAAG CAGGATACTCTGAATAGCGGGTCGAAATATATTCTGTGCCAGTTTCCATATCCTTCTGGG GCGCTTCACATAGGACATCTCCGAGTTTATGTCATTAGCGACTCTTTGAATAGATTTTAC AAACAAAAAGGGTACAACGTGATACATCCGATGGGATGGGATGCTTTTGGGTTACCTGCC GAGAACGCTGCTATAGAAAGAAGCATTAATCCGGCCATATGGACTAGGGACAATATTGCA AAAATGAAACAACAAATGCAAAGTATGCTGGCAAATTTTGATTGGGACAGAGAAATAACT ACATGTGATCCCGAATACTATAAATTCACCCAATGGATTTTCTTAAAACTTTTTGAAAAT GGCTTAGCTTATCGTAAAGAAGCAGAAATTAATTGGGATCCCGTTGATATGACAGTTTTG GCTAATGAACAAGTGGATGCCCAGGGCCGTTCTTGGAGATCAGGGGCTATTGTGGAAAAG AAGCAGCTAAAACAGTGGTTTTTGGGAATAACGAAATTCGCTCCTAAATTGAAAAAGCAC TTGAACCAACTGAAGGACTGGCCTTCCAACGTGAAGCAAATGCAAAAAAATTGGATAGGC GAATCTGTGGGTGCAGAATTAGTGTTCAAAGTTGCGGACCCCAAATTTGAAAACTTGATT GTCTTTACAACAAGACCGGAAACTCTTTTTGCTGTACAGTATGTTGCTCTCGCATTAGAC CACCCAATTGTACAAAAATACTGCGAGGAAATGCCGGATTTAAAAGAGTTTATACAGAAA AGTGATCAATTACCAAACGATACGAAGGAAGGATTTCAGTTACCTAACATAAAGGCCGTA AATCCCTTAACTAAAGAGGAAGTCCCCATATTTGCAGCTCCATATGTGGTCAGCAGCTAT GGTTCAGCACCTAGTGCAGTAATGGGTTGTCCAGGACACGATAACCGAGATTTTGAGTTT TGGCAAACAAATTGTCCTGGTGAACATATCAAGACGTGCATAGCACCTTTTTTTGACGAT GCTTCAAAAGTAACTGAACAGGAAAGACAAAGAATAATTGATACTGTCCCGTTCACATCT ACTGACGGTGTCCTAACCAAAGAATGCGGAGAACACTCAGGAGTTCTCACTGTAGTGGCA AGGAAATCGATAATGGGGATGTTGAATAGCGAAGGACTGTCTAAGAGCGTCGTTAGATAC AAAATTAGAGATTGGCTGATAAGTAGACAAAGATACTGGGGTACTCCAATACCCATCATT CACTGCGACAACTGTGGACCTGTCCCCGTTCCAGAAAGTGATCTACCTGTCAAGCTACCA GAACTTGAAGGCTTGGATACAAAAGGGAATCCGCTGTCCACAATCGATGAATTTGTAAAT GTCGCCTGTCCTTCATGCGGGAGCCCTGCGAAAAGAGAAACTGACACCATGGATACTTTT ATCGATAGTTCTTGGTATTATTTCAGATTCTTGGATCCCAAAAACACTTCAAAACCATTT GATCGTGAAATTGCAAGTAAAAATATGCCGGTTGATATTTATATTGGTGGAGTAGAACAT GCTATCTTACACTTGTTATACTCAAGGTTTATTGCTAAATTTCTCGGATCTATCAATGCA TGGAGCGACCCTGCTGGCATCTTCGAACCATTCAAAAAACTGGTGACACAAGGAATGGTT CAAGGGAAAACCTATGTTGACCCCGATTCTGGTAAATTTTTGAAGCCTGACGAGTTAACC TTTGTAAATGACTCTCCAGATGGCAACACAGTGATTATTAAATCAAATGGCAAGGTTCCG GTAGTCTCTTATGAAAAAATGTCGAAATCTAAATACAATGGTGCAGATCCAAATGAATGT ATTTTAAGACATGGACCTGATGCTACGAGAGCACATATCCTCTTCCAAAGTCCAATTGCA GATGCCCTGAATTGGGATGAATCCAAGATTGTTGGTATAGAACGTTGGTTGCAGAAGGTT CTTCATTTGACCAAAAATATTCTCAGTCTCGAGAAGGATTTGGCAATAAGTAAAGACTAC AAGACCCCGACCGACTTAAATGATGCAGAAGTGAAATTTCACAACGATTTCCAACGCTTC TTGAAATCAATTACGGAATCATTTGAAGTTAATCTATCGTTAAACACTGTAATATCTGAT TATATGAAGCTAACCAATATTTTAGAAAGTGCATTGAAAAAAGGTGAAGTAAGGAATGAA ATGATAGTACAGAATTTACAAAAGTTGGTAACCGTTATATATCCTGCTGTCCCGTCAATT TCAGAAGAAGCTGCAGAGATGATCAACTCCCAAATGGAATGGAACCAATACCGCTGGCCA GAAGTTGAGCGCACTACTGAGTCCAAATTCAAAAAGTTTCAAATTGTGGTAAATGGCAGA GTCAAATTCATGTACACGGCTGACAAAAACTTTTTGAAATTAGGTAGGGATGCTGTTATT GAAACTTTGATGAACTTACCGGAAGGGAGAATGTATTTGATGAATAAAAAAATCAAAAAA TTTGTCATGAAATTCAATGTGATTAGTTTCTTATTCCACAAGTAA
Protein Properties
Pfam Domain Function
Protein Residues894
Protein Molecular Weight101920.0
Protein Theoretical pI8.56
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Leucyl-tRNA synthetase, mitochondrial MLSRPSSRFLSTKRGPGPAVKKLIAIGEKWKQKTTRGLPKQDTLNSGSKYILCQFPYPSG ALHIGHLRVYVISDSLNRFYKQKGYNVIHPMGWDAFGLPAENAAIERSINPAIWTRDNIA KMKQQMQSMLANFDWDREITTCDPEYYKFTQWIFLKLFENGLAYRKEAEINWDPVDMTVL ANEQVDAQGRSWRSGAIVEKKQLKQWFLGITKFAPKLKKHLNQLKDWPSNVKQMQKNWIG ESVGAELVFKVADPKFENLIVFTTRPETLFAVQYVALALDHPIVQKYCEEMPDLKEFIQK SDQLPNDTKEGFQLPNIKAVNPLTKEEVPIFAAPYVVSSYGSAPSAVMGCPGHDNRDFEF WQTNCPGEHIKTCIAPFFDDASKVTEQERQRIIDTVPFTSTDGVLTKECGEHSGVLTVVA RKSIMGMLNSEGLSKSVVRYKIRDWLISRQRYWGTPIPIIHCDNCGPVPVPESDLPVKLP ELEGLDTKGNPLSTIDEFVNVACPSCGSPAKRETDTMDTFIDSSWYYFRFLDPKNTSKPF DREIASKNMPVDIYIGGVEHAILHLLYSRFIAKFLGSINAWSDPAGIFEPFKKLVTQGMV QGKTYVDPDSGKFLKPDELTFVNDSPDGNTVIIKSNGKVPVVSYEKMSKSKYNGADPNEC ILRHGPDATRAHILFQSPIADALNWDESKIVGIERWLQKVLHLTKNILSLEKDLAISKDY KTPTDLNDAEVKFHNDFQRFLKSITESFEVNLSLNTVISDYMKLTNILESALKKGEVRNE MIVQNLQKLVTVIYPAVPSISEEAAEMINSQMEWNQYRWPEVERTTESKFKKFQIVVNGR VKFMYTADKNFLKLGRDAVIETLMNLPEGRMYLMNKKIKKFVMKFNVISFLFHK
References
External Links
ResourceLink
Saccharomyces Genome Database NAM2
Uniprot IDP11325
Uniprot NameSYLM_YEAST
GenBank Gene IDJ03495
Genebank Protein ID172008
General Reference
  • Tzagoloff, A., Akai, A., Kurkulos, M., Repetto, B. (1988). "Homology of yeast mitochondrial leucyl-tRNA synthetase and isoleucyl- and methionyl-tRNA synthetases of Escherichia coli." J Biol Chem 263:850-856.2826465
  • Labouesse, M., Herbert, C. J., Dujardin, G., Slonimski, P. P. (1987). "Three suppressor mutations which cure a mitochondrial RNA maturase deficiency occur at the same codon in the open reading frame of the nuclear NAM2 gene." EMBO J 6:713-721.3034607
  • Johnston, M., Hillier, L., Riles, L., Albermann, K., Andre, B., Ansorge, W., Benes, V., Bruckner, M., Delius, H., Dubois, E., Dusterhoft, A., Entian, K. D., Floeth, M., Goffeau, A., Hebling, U., Heumann, K., Heuss-Neitzel, D., Hilbert, H., Hilger, F., Kleine, K., Kotter, P., Louis, E. J., Messenguy, F., Mewes, H. W., Hoheisel, J. D., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XII." Nature 387:87-90.9169871
  • Zagorski, W., Castaing, B., Herbert, C. J., Labouesse, M., Martin, R., Slonimski, P. P. (1991). "Purification and characterization of the Saccharomyces cerevisiae mitochondrial leucyl-tRNA synthetase." J Biol Chem 266:2537-2541.1990003
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106