You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePyruvate carboxylase 1
Synonyms
  • Pyruvic carboxylase 1
  • PCB 1
Gene NamePYC1
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionPyruvate carboxylase catalyzes a 2-step reaction, involving the ATP-dependent carboxylation of the covalently attached biotin in the first step and the transfer of the carboxyl group to pyruvate in the second
Cellular LocationCytoplasm
SMPDB Pathways
Pyruvate metabolismPW002447 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Citrate cycle (TCA cycle)ec00020 Map00020
Pyruvate metabolismec00620 Map00620
SMPDB Reactions
Adenosine triphosphate + Pyruvic acid + Hydrogen carbonateADP + phosphate + Oxalacetic acid
KEGG Reactions
Pyruvic acid + Carbonic acid + Adenosine triphosphatephosphate + hydron + Oxalacetic acid + ADP
Metabolites
YMDB IDNameView
YMDB00109Adenosine triphosphateShow
YMDB00175Pyruvic acidShow
YMDB00235Oxalacetic acidShow
YMDB00382Carbonic acidShow
YMDB00862hydronShow
YMDB00907phosphateShow
YMDB00914ADPShow
YMDB16118Hydrogen carbonateShow
GO Classification
Component
cytoplasm
cell part
intracellular part
Function
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
ligase activity, forming carbon-carbon bonds
adenyl ribonucleotide binding
pyruvate carboxylase activity
catalytic activity
ATP binding
vitamin binding
biotin binding
ligase activity
binding
Process
monosaccharide metabolic process
hexose metabolic process
glucose metabolic process
gluconeogenesis
metabolic process
small molecule metabolic process
alcohol metabolic process
Gene Properties
Chromosome Locationchromosome 7
LocusYGL062W
Gene Sequence>3537 bp ATGTCGCAAAGAAAATTCGCCGGCTTGAGAGATAACTTCAATCTCTTGGGTGAAAAGAAC AAAATATTGGTGGCTAATAGAGGAGAAATTCCAATCAGAATTTTTCGTACCGCTCATGAA CTGTCTATGCAGACGGTAGCTATATATTCTCATGAAGATCGTCTTTCAACGCACAAACAA AAGGCTGACGAAGCATACGTCATAGGTGAAGTAGGCCAATATACCCCCGTCGGCGCTTAT TTGGCCATTGACGAAATCATTTCCATTGCCCAAAAACACCAGGTAGATTTCATCCATCCA GGTTATGGGTTCTTGTCTGAAAATTCGGAATTTGCCGACAAAGTAGTGAAGGCCGGTATC ACTTGGATTGGCCCTCCAGCTGAAGTTATTGACTCCGTGGGTGATAAGGTCTCAGCTAGA AACCTGGCAGCAAAAGCTAATGTGCCCACCGTTCCTGGTACACCAGGTCCTATAGAAACT GTAGAGGAAGCACTTGACTTCGTCAATGAATACGGCTACCCGGTGATCATTAAGGCCGCC TTTGGTGGTGGTGGTAGAGGTATGAGAGTCGTTAGAGAAGGTGACGACGTGGCAGATGCC TTTCAACGTGCTACCTCCGAAGCCCGTACTGCCTTCGGTAATGGTACCTGCTTTGTGGAA AGATTCTTGGACAAGCCAAAGCATATTGAAGTTCAATTGTTGGCCGATAACCACGGAAAC GTGGTTCATCTTTTCGAAAGAGACTGTTCCGTGCAGAGAAGACACCAAAAGGTTGTCGAA GTGGCCCCAGCAAAGACTTTACCCCGTGAAGTCCGTGACGCCATTTTGACAGATGCAGTT AAATTGGCCAAAGAGTGTGGCTACAGAAATGCGGGTACTGCTGAATTCTTGGTTGATAAC CAAAATAGACACTATTTCATTGAAATTAATCCAAGAATCCAAGTGGAACATACCATCACA GAAGAAATTACCGGTATAGATATTGTGGCGGCTCAGATCCAAATTGCGGCAGGTGCCTCT CTACCCCAGCTGGGCCTATTCCAGGACAAAATTACGACTCGTGGCTTTGCCATTCAGTGC CGTATTACCACGGAAGACCCTGCTAAGAACTTCCAACCAGATACCGGTAGAATAGAAGTG TACCGTTCTGCAGGTGGTAATGGTGTTAGACTGGATGGTGGTAACGCCTATGCAGGAACA ATAATCTCACCTCATTACGACTCAATGCTGGTCAAATGCTCATGCTCCGGTTCCACCTAC GAAATCGTTCGTAGAAAAATGATTCGTGCATTAATCGAGTTCAGAATTAGAGGTGTCAAG ACCAACATTCCCTTCCTATTGACTCTTTTGACCAATCCAGTATTTATTGAGGGTACATAC TGGGGGACTTTTATTGACGACACCCCACAACTGTTCCAAATGGTTTCATCACAAAACAGG GCCCAAAAACTTTTACATTACCTCGCCGACGTGGCAGACAATGGTTCATCTATCAAGGGT CAAATTGGCTTGCCAAAATTAAAATCAAATCCAAGTGTCCCCCATTTGCACGATGCTCAG GGCAATGTCATCAACGTTACAAAGTCTGCACCACCATCCGGATGGAGGCAAGTGCTACTA GAAAAGGGGCCAGCTGAATTTGCCAGACAAGTTAGACAGTTCAATGGTACTTTATTGATG GACACCACCTGGAGAGACGCTCATCAATCTCTACTTGCAACAAGAGTCAGAACCCACGAT TTGGCTACAATCGCTCCAACAACCGCACATGCCCTTGCAGGTGCTTTCGCCTTAGAATGT TGGGGTGGTGCCACATTCGATGTTGCAATGAGATTTTTGCATGAGGATCCATGGCAACGT TTGAGAAAATTAAGATCTCTGGTGCCTAATATTCCATTCCAAATGTTATTGCGTGGTGCC AATGGTGTGGCTTATTCTTCATTGCCTGACAATGCTATTGACCATTTCGTCAAGCAAGCC AAGGATAATAGTGTTGATATATTTAGAGTCTTTGATGCCTTAAATGACTTGGAACAATTG AAGGTCGGTGTAGATGCTGTGAAGAAGGCAGGTGGTGTTGTAGAAGCCACTGTTTGTTTC TCTGGGGATATGCTTCAGCCAGGCAAGAAATACAATTTGGATTACTACTTGGAAATTGCT GAAAAAATTGTCCAAATGGGCACTCATATCCTGGGTATCAAAGATATGGCAGGTACCATG AAGCCAGCAGCTGCCAAACTACTGATTGGATCTTTGAGGGCTAAGTACCCTGATCTCCCA ATACATGTTCACACTCACGATTCTGCAGGTACTCGTGTTGCATCAATGACTGCGTGTGCT CTGGCGGGCGCCGATGTCGTTGATGTTGCCATCAACTCAATGTCTGGTTTAACTTCACAA CCATCAATCAATGCTCTGTTGGCTTCATTAGAAGGTAATATTGACACTGGTATTAACGTT GAGCATGTCCGTGAACTAGATGCATATTGGGCAGAGATGAGATTGTTATACTCTTGTTTC GAGGCTGACTTGAAGGGCCCAGATCCAGAAGTTTATCAACATGAAATCCCAGGTGGTCAA TTGACAAACTTGTTGTTTCAAGCCCAACAATTGGGTCTTGGAGAACAATGGGCCCAAACA AAAAGAGCTTACAGAGAAGCCAATTATTTATTGGGTGATATTGTCAAAGTTACCCCAACT TCGAAGGTCGTTGGTGATCTGGCAAAATTTATGGTCTCCAATAAATTAACTTCCGATGAT GTGAGACGCCTGGCTAATTCTTTGGATTTCCCTGACTCTGTTATGGATTTCTTCGAAGGC TTAATCGGCCAACCATATGGTGGGTTCCCAGAACCATTTAGATCAGACGTTTTAAGGAAC AAGAGAAGAAAGTTGACTTGTCGTCCAGGCCTGGAACTAGAGCCATTTGATCTCGAAAAA ATTAGAGAAGACTTGCAGAATAGATTTGGTGATGTTGATGAGTGCGACGTTGCTTCTTAT AACATGTACCCAAGAGTTTATGAAGACTTCCAAAAGATGAGAGAAACGTATGGTGATTTA TCTGTATTGCCAACAAGAAGCTTTTTGTCTCCACTAGAGACTGACGAAGAAATTGAAGTT GTAATCGAACAAGGTAAAACGCTAATTATCAAGCTACAGGCTGTGGGTGATTTGAACAAA AAGACCGGTGAAAGAGAAGTTTACTTTGATTTGAATGGTGAAATGAGAAAAATTCGTGTT GCTGACAGATCACAAAAAGTGGAAACTGTTACTAAATCCAAAGCAGACATGCATGATCCA TTACACATTGGTGCACCAATGGCAGGTGTCATTGTTGAAGTTAAAGTTCATAAAGGATCA CTAATAAAGAAGGGCCAACCTGTAGCCGTATTAAGCGCCATGAAAATGGAAATGATTATA TCTTCTCCATCCGATGGACAAGTTAAAGAAGTGTTTGTCTCTGATGGTGAAAATGTGGAC TCTTCTGATTTATTAGTTCTATTAGAAGACCAAGTTCCTGTTGAAACTAAGGCATGA
Protein Properties
Pfam Domain Function
Protein Residues1178
Protein Molecular Weight130098.0
Protein Theoretical pI6.15
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Pyruvate carboxylase 1 MSQRKFAGLRDNFNLLGEKNKILVANRGEIPIRIFRTAHELSMQTVAIYSHEDRLSTHKQ KADEAYVIGEVGQYTPVGAYLAIDEIISIAQKHQVDFIHPGYGFLSENSEFADKVVKAGI TWIGPPAEVIDSVGDKVSARNLAAKANVPTVPGTPGPIETVEEALDFVNEYGYPVIIKAA FGGGGRGMRVVREGDDVADAFQRATSEARTAFGNGTCFVERFLDKPKHIEVQLLADNHGN VVHLFERDCSVQRRHQKVVEVAPAKTLPREVRDAILTDAVKLAKECGYRNAGTAEFLVDN QNRHYFIEINPRIQVEHTITEEITGIDIVAAQIQIAAGASLPQLGLFQDKITTRGFAIQC RITTEDPAKNFQPDTGRIEVYRSAGGNGVRLDGGNAYAGTIISPHYDSMLVKCSCSGSTY EIVRRKMIRALIEFRIRGVKTNIPFLLTLLTNPVFIEGTYWTTFIDDTPQLFQMVSSQNR AQKLLHYLADVAVNGSSIKGQIGLPKLKSNPSVPHLHDAQGNVINVTKSAPPSGWRQVLL EKGPAEFARQVRQFNGTLLMDTTWRDAHQSLLATRVRTHDLATIAPTTAHALAGRFALEC WGGATFDVAMRFLHEDPWERLRKLRSLVPNIPFQMLLRGANGVAYSSLPDNAIDHFVKQA KDNGVDIFRVFDALNDLEQLKVGVDAVKKAGGVVEATVCFSGDMLQPGKKYNLDYYLEIA EKIVQMGTHILGIKDMAGTMKPAAAKLLIGSLRAKYPDLPIHVHTHDSAGTAVASMTACA LAGADVVDVAINSMSGLTSQPSINALLASLEGNIDTGINVEHVRELDAYWAEMRLLYSCF EADLKGPDPEVYQHEIPGGQLTNLLFQAQQLGLGEQWAETKRAYREANYLLGDIVKVTPT SKVVGDLAQFMVSNKLTSDDVRRLANSLDFPDSVMDFFEGLIGQPYGGFPEPFRSDVLRN KRRKLTCRPGLELEPFDLEKIREDLQNRFGDVDECDVASYNMYPRVYEDFQKMRETYGDL SVLPTRSFLSPLETDEEIEVVIEQGKTLIIKLQAVGDLNKKTGEREVYFDLNGEMRKIRV ADRSQKVETVTKSKADMHDPLHIGAPMAGVIVEVKVHKGSLIKKGQPVAVLSAMKMEMII SSPSDGQVKEVFVSDGENVDSSDLLVLLEDQVPVETKA
References
External Links
ResourceLink
Saccharomyces Genome Database PYC1
Uniprot IDP11154
Uniprot NamePYC1_YEAST
GenBank Gene IDJ03889
Genebank Protein ID172102
General Reference
  • Lim, F., Morris, C. P., Occhiodoro, F., Wallace, J. C. (1988). "Sequence and domain structure of yeast pyruvate carboxylase." J Biol Chem 263:11493-11497.3042770
  • Feuermann, M., de Montigny, J., Potier, S., Souciet, J. L. (1997). "The characterization of two new clusters of duplicated genes suggests a 'Lego' organization of the yeast Saccharomyces cerevisiae chromosomes." Yeast 13:861-869.9234674
  • Tettelin, H., Agostoni Carbone, M. L., Albermann, K., Albers, M., Arroyo, J., Backes, U., Barreiros, T., Bertani, I., Bjourson, A. J., Bruckner, M., Bruschi, C. V., Carignani, G., Castagnoli, L., Cerdan, E., Clemente, M. L., Coblenz, A., Coglievina, M., Coissac, E., Defoor, E., Del Bino, S., Delius, H., Delneri, D., de Wergifosse, P., Dujon, B., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome VII." Nature 387:81-84.9169869
  • Morris, C. P., Lim, F., Wallace, J. C. (1987). "Yeast pyruvate carboxylase: gene isolation." Biochem Biophys Res Commun 145:390-396.3036126
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106