You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePhosphoenolpyruvate carboxykinase [ATP]
SynonymsNot Available
Gene NamePCK1
Enzyme Class
Biological Properties
General FunctionInvolved in phosphoenolpyruvate carboxykinase (ATP) activity
Specific FunctionATP + oxaloacetate = ADP + phosphoenolpyruvate + CO(2)
Cellular LocationNot Available
SMPDB Pathways
Pyruvate metabolismPW002447 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Citrate cycle (TCA cycle)ec00020 Map00020
Glycolysis / Gluconeogenesisec00010 Map00010
Pyruvate metabolismec00620 Map00620
SMPDB Reactions
Adenosine triphosphate + Oxalacetic acidADP + Phosphoenolpyruvic acid
KEGG Reactions
Adenosine triphosphate + Oxalacetic acidPhosphoenolpyruvic acid + Carbon dioxide + ADP
Metabolites
YMDB IDNameView
YMDB00109Adenosine triphosphateShow
YMDB00235Oxalacetic acidShow
YMDB00276Phosphoenolpyruvic acidShow
YMDB00912Carbon dioxideShow
YMDB00914ADPShow
GO Classification
Component
Not Available
Function
purine nucleoside binding
purine nucleotide binding
adenyl nucleotide binding
adenyl ribonucleotide binding
catalytic activity
ATP binding
phosphoenolpyruvate carboxykinase (ATP) activity
nucleotide binding
phosphoenolpyruvate carboxykinase activity
oxidoreductase activity
lyase activity
carbon-carbon lyase activity
carboxy-lyase activity
binding
nucleoside binding
Process
glucose metabolic process
gluconeogenesis
metabolic process
oxidation reduction
small molecule metabolic process
alcohol metabolic process
monosaccharide metabolic process
hexose metabolic process
Gene Properties
Chromosome Locationchromosome 11
LocusYKR097W
Gene Sequence>1650 bp ATGTCCCCTTCTAAAATGAATGCTACAGTAGGATCTACTTCCGAAGTTGAACAAAAAATC AGACAAGAATTGGCTCTTAGTGACGAAGTCACCACCATCAGACGCAATGCTCCAGCTGCC GTTTTGTATGAAGATGGTCTAAAAGAAAATAAAACTGTCATTTCATCAAGCGGTGCATTG ATCGCTTATTCCGGTGTTAAAACCGGAAGATCTCCAAAGGACAAACGTATTGTTGAAGAA CCTACTTCGAAAGACGAAATTTGGTGGGGTCCGGTCAATAAACCATGTTCTGAAAGAACA TGGTCTATCAACCGTGAAAGAGCTGCAGATTACTTGAGAACAAGAGACCACATTTATATT GTCGATGCATTCGCTGGATGGGATCCAAAATACAGAATCAAAGTCCGTGTTGTTTGTGCC AGGGCTTACCACGCTTTATTCATGACAAATATGCTTATTAGACCTACAGAAGAAGAATTA GCCCATTTTGGAGAACCTGATTTTACTGTCTGGAACGCTGGTCAGTTCCCAGCCAATTTA CACACCCAGGATATGTCTTCAAAGAGTACTATAGAAATTAACTTCAAAGCAATGGAAATG ATCATTTTAGGTACCGAATACGCCGGTGAAATGAAAAAAGGTATTTTCACAGTTATGTTT TACTTGATGCCTGTGCACCATAACGTTTTAACTTTGCACTCTTCCGCCAACCAGGGTATT CAAAACGGTGACGTTACTTTATTCTTTGGCCTAAGTGGTACCGGGAAAACCACTTTATCC GCAGACCCACATAGATTGTTGATCGGCGATGATGAACATTGTTGGTCCGACCATGGTGTC TTCAATATCGAAGGTGGTTGTTACGCCAAGTGTATTAATCTATCTGCTGAAAAGGAGCCT GAAATTTTCGACGCTATCAAGTTTGGTTCTGTATTAGAAAACGTTATCTATGACGAGAAG TCGCACGTAGTCGACTATGACGACTCTTCTATTACTGAAAATACTAGATGTGCCTACCCA ATTGACTACATTCCAAGTGCCAAGATTCCATGTTTGGCGGACTCTCATCCAAAGAACATT ATCCTGCTAACTTGTGATGCTTCGGGTGTTTTACCACCAGTATCTAAATTGACTCCTGAA CAAGTCATGTACCATTTCATCTCTGGTTACACTTCTAAAATGGCTGGTACTGAGCAAGGT GTCACTGAACCTGAACCAACATTTTCATCTTGTTTCGGACAACCCTTCCTAGCCTTACAC CCTATTAGATACGCAACCATGTTAGCTACAAACATGTCTCAACATAAAGCTAATGCGTAC TTAATCAACACCGGCTGGACTGGTTCTTCCTACGTATCTGGTGGTAAACGTTGCCCATTG AAGTACACAAGGGCCATTCTGGATTCTATTCATGATGGTTCGTTAGCCAATGAAACGTAC GAAACTTTACCGATTTTCAATCTTCAAGTACCTACCAAGGTTAACGGTGTTCCAGCTGAG CTCTTGAATCCTGCTAAAAACTGGTCTCAAGGTGAATCCAAATACAGAGGTGCAGTTACC AACTTGGCCAACTTGTTTGTTCAAAATTTCAAGATTTATCAAGACAGAGCCACACCAGAT GTATTAGCCGCTGGTCCTCAATTCGAGTAA
Protein Properties
Pfam Domain Function
Protein Residues549
Protein Molecular Weight60982.69922
Protein Theoretical pI6.31
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Phosphoenolpyruvate carboxykinase [ATP] MSPSKMNATVGSTSEVEQKIRQELALSDEVTTIRRNAPAAVLYEDGLKENKTVISSSGAL IAYSGVKTGRSPKDKRIVEEPTSKDEIWWGPVNKPCSERTWSINRERAADYLRTRDHIYI VDAFAGWDPKYRIKVRVVCARAYHALFMTNMLIRPTEEELAHFGEPDFTVWNAGQFPANL HTQDMSSKSTIEINFKAMEMIILGTEYAGEMKKGIFTVMFYLMPVHHNVLTLHSSANQGI QNGDVTLFFGLSGTGKTTLSADPHRLLIGDDEHCWSDHGVFNIEGGCYAKCINLSAEKEP EIFDAIKFGSVLENVIYDEKSHVVDYDDSSITENTRCAYPIDYIPSAKIPCLADSHPKNI ILLTCDASGVLPPVSKLTPEQVMYHFISGYTSKMAGTEQGVTEPEPTFSSCFGQPFLALH PIRYATMLATKMSQHKANAYLINTGWTGSSYVSGGKRCPLKYTRAILDSIHDGSLANETY ETLPIFNLQVPTKVNGVPAELLNPAKNWSQGESKYRGAVTNLANLFVQNFKIYQDRATPD VLAAGPQFE
References
External Links
ResourceLink
Saccharomyces Genome Database PCK1
Uniprot IDP10963
Uniprot NamePCKA_YEAST
GenBank Gene IDU24234
Genebank Protein ID1000080
General Reference
  • Stucka, R., Valdes-Hevia, M. D., Gancedo, C., Schwarzlose, C., Feldmann, H. (1988). "Nucleotide sequence of the phosphoenolpyruvate carboxykinase gene from Saccharomyces cerevisiae." Nucleic Acids Res 16:10926.3060853
  • Krautwurst, H., Encinas, M. V., Marcus, F., Latshaw, S. P., Kemp, R. G., Frey, P. A., Cardemil, E. (1995). "Saccharomyces cerevisiae phosphoenolpyruvate carboxykinase: revised amino acid sequence, site-directed mutagenesis, and microenvironment characteristics of cysteines 365 and 458." Biochemistry 34:6382-6388.7756267
  • Dujon, B., Alexandraki, D., Andre, B., Ansorge, W., Baladron, V., Ballesta, J. P., Banrevi, A., Bolle, P. A., Bolotin-Fukuhara, M., Bossier, P., et, a. l. .. (1994). "Complete DNA sequence of yeast chromosome XI." Nature 369:371-378.8196765
  • Alvear, M., Encinas, M. V., Kemp, R. G., Latshaw, S. P., Cardemil, E. (1992). "ATP-dependent Saccharomyces cerevisiae phospho enol pyruvate carboxykinase: isolation and sequence of a peptide containing a highly reactive cysteine." Biochim Biophys Acta 1119:35-38.1540632
  • Peng, J., Schwartz, D., Elias, J. E., Thoreen, C. C., Cheng, D., Marsischky, G., Roelofs, J., Finley, D., Gygi, S. P. (2003). "A proteomics approach to understanding protein ubiquitination." Nat Biotechnol 21:921-926.12872131