You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameInvertase 5
Synonyms
  • Beta-fructofuranosidase 5
  • Saccharase
  • Fragment
Gene NameSUC5
Enzyme Class
Biological Properties
General FunctionInvolved in hydrolase activity, hydrolyzing O-glycosyl compounds
Specific FunctionHydrolysis of terminal non-reducing beta-D- fructofuranoside residues in beta-D-fructofuranosides
Cellular LocationCytoplasmic
SMPDB Pathways
Starch and sucrose metabolismPW002481 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Galactose metabolismec00052 Map00052
Starch and sucrose metabolismec00500 Map00500
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00286D-GlucoseShow
YMDB00657D-FructoseShow
YMDB00890waterShow
YMDB00906SucroseShow
GO Classification
Component
Not Available
Function
hydrolase activity
hydrolase activity, acting on glycosyl bonds
hydrolase activity, hydrolyzing O-glycosyl compounds
catalytic activity
Process
primary metabolic process
carbohydrate metabolic process
metabolic process
Gene Properties
Chromosome Locationchromosome 4
LocusSUC5
Gene Sequence>222 bp ATGCTTTTGCAAGCTTTCATTTTCCTTTTGGCTGGCTTTGCAGCTAAGATATCAGCATTA ATGACAAACGAAACTAGCGATAGACCTTTGGTCCACTTCACCCCCAACAAGGGTTGGATG AATGATCCAAATGGATTGTGGTACGATGCAAAAGAAGGTAAATGGCATCTCTACTTTCAG TACAATCCAAATGACACTGTTTGGGGTTTGCCACTCTTCTGG
Protein Properties
Pfam Domain Function
Protein Residues74
Protein Molecular Weight8649.90039
Protein Theoretical pI6.51
Signalling Regions
  • 1-19
Transmembrane Regions
  • None
Protein Sequence>Invertase 5 MLLQAFIFLLAGFAAKISALMTNETSDRPLVHFTPNKGWMNDPNGLWYDAKEGKWHLYFQ YNPNDTVWGLPLFW
References
External Links
ResourceLink
Saccharomyces Genome Database SUC5
Uniprot IDP10597
Uniprot NameINV5_YEAST
GenBank Gene IDX07573
Genebank Protein ID4575
General Reference
  • Hohmann, S., Gozalbo, D. (1988). "Structural analysis of the 5' regions of yeast SUC genes revealed analogous palindromes in SUC, MAL and GAL." Mol Gen Genet 211:446-454.2835632