You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameInvertase 1
Synonyms
  • Beta-fructofuranosidase 1
  • Saccharase
Gene NameSUC1
Enzyme Class
Biological Properties
General FunctionInvolved in hydrolase activity, hydrolyzing O-glycosyl compounds
Specific FunctionHydrolysis of terminal non-reducing beta-D- fructofuranoside residues in beta-D-fructofuranosides
Cellular LocationCytoplasmic
SMPDB Pathways
Starch and sucrose metabolismPW002481 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Galactose metabolismec00052 Map00052
Starch and sucrose metabolismec00500 Map00500
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00286D-GlucoseShow
YMDB00657D-FructoseShow
YMDB00890waterShow
YMDB00906SucroseShow
GO Classification
Component
Not Available
Function
hydrolase activity
hydrolase activity, acting on glycosyl bonds
hydrolase activity, hydrolyzing O-glycosyl compounds
catalytic activity
Process
metabolic process
primary metabolic process
carbohydrate metabolic process
Gene Properties
Chromosome Locationchromosome 7
LocusSUC1
Gene Sequence>1599 bp ATGCTTTTGCAAGCTTTCCTTTTCCTTTTGGCTGGTTTTGCAGCTAAAATATCAGCATCA ATGACAAACGAAACTAGCGATAGACCTTTGGTCCACTTCACTCCCAACAAGGGTTGGATG AATGACCCAAATGGATTGTGGTACGATGCAAAAGAAGGTAAATGGCATCTCTACTTTCAG TACAACCCAAATGACACTGTTTGGGGTTTGCCACTCTTCTGGGGTCATGCTACTTCGGAT GATTTGACTCACTGGCAAGATGAACCTGTTGCTATCGCGCCCAAGCGTAAGGACTCTGGT GCTTATTCTGGTTCGATGGTGATTGACTACAACAACACTAGTGGGTTTTTCAATGATACT ATTGATCCAAGACAAAGATGCGTTGCGATTTGGACTTATAATACTCCAGAAAGTGAAGAG CAATACATTAGCTATTCCCTTGATGGTGGTTACACTTTTACTGAATACCAAAAGAACCCT GTTTTAGCTGCCAACTCCACTCAATTCAGAGATCCAAAGGTGTTCTGGTATGAACCTTCT AAAAAATGGATTATGACAGCTGCCAAATCACAAGATTACAAAATTGAAATTTACTCCTCC GACGACTTGAAGTCCTGGAAGCTAGAGTCTGCATTTGCCAATGAAGGTTTCTTAGGTTAC CAATACGAGTGTCCCGGTTTGATCGAAGTCCCAAGTGAGCAAGATCCTTCTAAATCCCAT TGGGTCATGTTTATTTCCATCAACCCAGGTGCACCAGCTGGCGGTTCCTTCAACCAATAT TTTGTTGGATCCTTCAATGGTCATCATTTTGAAGCGTTTGACAATCAATCTAGAGTGGTA GATTTTGGTAAGGACTACTATGCCTTGCAAACTTTCTTCAACACAGACCCAACCTACGGT TCAGCATTAGGTATTGCCTGGGCTTCAAACTGGGAGTACAGTGCCTTTGTCCCAAGTAAC CCATGGAGGTCATCCATGTCTTTGGTCCGCCCGTTTTCTTTGAACACTGAATATCAAGCT AATCCAGAGACTGAATTGATCAATTTGAAAGCCGAACCAATATTGAACATTAGTAGTGCT GGCCCCTGGTCTCGTTTTGCTACTAACACAACTCTAACTAAGGCCAATTCTTACAATGTC GATTTGAGCAACTCGACTGGTACCCTAGAGTTTGAGTTGGTTTACGCTGTTAACACCACA CAAACCATATCCAAATCCGTCTTTGCCGACTTATCACTTTGGTTCAAGGGTTTAGAAGAT CCTGAAGAATATTTGAGAATGGGTTTTGAAGTCAGTGCTTCTTCCTTCTTTTTGGACCGT GGTAACTCTAAGGTCAAGTTTGTCAAGGAGAACCCATATTTCACAAACAGAATGTCTGTC AACAACCAACCATTCAAGTCTGAGAACGACCTAAGTTACTATAAAGTGTACGGCCTACTG GATCAAAACATCTTGGAATTGTACTTCAACGATGGAGATGTGGTTTCTACAAATACCTAC TTCATGACCACCGGTAACGCTCTAGGATCTGTGAACATGACCACTGGTGTCGATAATTTG TTCTACATTGACAAGTTCCAAGTAAGGGAAGTAAAATAG
Protein Properties
Pfam Domain Function
Protein Residues532
Protein Molecular Weight60569.89844
Protein Theoretical pI4.53
Signalling Regions
  • 1-19
Transmembrane Regions
  • None
Protein Sequence>Invertase 1 MLLQAFLFLLAGFAAKISASMTNETSDRPLVHFTPNKGWMNDPNGLWYDAKEGKWHLYFQ YNPNDTVWGLPLFWGHATSDDLTHWQDEPVAIAPKRKDSGAYSGSMVIDYNNTSGFFNDT IDPRQRCVAIWTYNTPESEEQYISYSLDGGYTFTEYQKNPVLAANSTQFRDPKVFWYEPS KKWIMTAAKSQDYKIEIYSSDDLKSWKLESAFANEGFLGYQYECPGLIEVPSEQDPSKSH WVMFISINPGAPAGGSFNQYFVGSFNGHHFEAFDNQSRVVDFGKDYYALQTFFNTDPTYG SALGIAWASNWEYSAFVPSNPWRSSMSLVRPFSLNTEYQANPETELINLKAEPILNISSA GPWSRFATNTTLTKANSYNVDLSNSTGTLEFELVYAVNTTQTISKSVFADLSLWFKGLED PEEYLRMGFEVSASSFFLDRGNSKVKFVKENPYFTNRMSVNNQPFKSENDLSYYKVYGLL DQNILELYFNDGDVVSTNTYFMTTGNALGSVNMTTGVDNLFYIDKFQVREVK
References
External Links
ResourceLink
Saccharomyces Genome Database SUC1
Uniprot IDP10594
Uniprot NameINV1_YEAST
GenBank Gene IDX07570
Genebank Protein ID4568
General Reference
  • Hohmann, S., Gozalbo, D. (1988). "Structural analysis of the 5' regions of yeast SUC genes revealed analogous palindromes in SUC, MAL and GAL." Mol Gen Genet 211:446-454.2835632
  • Rodriguez, L., Lampen, J. O., MacKay, V. L. (1981). "SUC1 gene of Saccharomyces: a structural gene for the large (glycoprotein) and small (carbohydrate-free) forms of invertase." Mol Cell Biol 1:469-474.6765604