You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
Name5-aminolevulinate synthase, mitochondrial
Synonyms
  • 5-aminolevulinic acid synthase
  • Delta-ALA synthase
  • Delta-aminolevulinate synthase
Gene NameHEM1
Enzyme Class
Biological Properties
General FunctionInvolved in 5-aminolevulinate synthase activity
Specific FunctionSuccinyl-CoA + glycine = 5-aminolevulinate + CoA + CO(2)
Cellular LocationMitochondrion matrix
SMPDB Pathways
Biosynthesis of unsaturated fatty acids (docosanoyl)PW002408 ThumbThumb?image type=greyscaleThumb?image type=simple
Biosynthesis of unsaturated fatty acids (tetracosanoyl-CoA)PW002404 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Glycine, serine and threonine metabolismec00260 Map00260
Porphyrin and chlorophyll metabolismec00860 Map00860
SMPDB ReactionsNot Available
KEGG Reactions
Glycine + hydron + Succinyl-CoA5-Aminolevulinic acid + Carbon dioxide + Coenzyme A
Metabolites
YMDB IDNameView
YMDB00016GlycineShow
YMDB00045Coenzyme AShow
YMDB000835-Aminolevulinic acidShow
YMDB00514Succinyl-CoAShow
YMDB00862hydronShow
YMDB00912Carbon dioxideShow
GO Classification
Component
Not Available
Function
acyltransferase activity
N-acyltransferase activity
N-succinyltransferase activity
5-aminolevulinate synthase activity
catalytic activity
transferase activity
binding
transferase activity, transferring nitrogenous groups
cofactor binding
pyridoxal phosphate binding
transferase activity, transferring acyl groups
transferase activity, transferring acyl groups other than amino-acyl groups
Process
cellular biosynthetic process
heterocycle biosynthetic process
tetrapyrrole biosynthetic process
metabolic process
biosynthetic process
Gene Properties
Chromosome Locationchromosome 4
LocusYDR232W
Gene Sequence>1647 bp ATGCAACGCTCCATTTTTGCGAGGTTCGGTAACTCCTCTGCCGCTGTTTCCACACTGAAT AGGCTGTCCACGACAGCCGCACCACATGCGAAAAATGGCTATGCCACCGCTACTGGTGCT GGTGCCGCTGCTGCCACTGCCACAGCGTCATCAACACATGCAGCAGCAGCAGCAGCCGCT GCTGCCAACCATTCCACCCAGGAGTCGGGTTTCGATTACGAAGGCCTGATAGATTCCGAA CTGCAGAAGAAAAGACTTGACAAATCGTACAGATATTTCAACAATATCAACCGATTGGCC AAGGAGTTCCCCCTAGCTCATCGCCAGAGAGAGGCGGACAAGGTCACCGTTTGGTGTTCC AACGACTATTTAGCACTTTCCAAGCACCCTGAGGTATTGGACGCCATGCATAAAACTATC GACAAGTATGGTTGTGGTGCCGGTGGTACAAGAAACATTGCTGGCCATAACATCCCCACT TTGAATCTGGAAGCCGAATTGGCCACTTTACACAAGAAGGAAGGTGCCTTAGTTTTTTCG TCATGTTACGTAGCCAACGATGCCGTCTTATCCCTACTGGGTCAAAAGATGAAGGACTTG GTGATTTTCTCCGACGAACTCAACCATGCGTCCATGATTGTCGGTATTAAGCATGCTAAC GTAAAAAAACACATTTTCAAACATAATGACTTGAACGAATTGGAACAACTGCTCCAGTCA TACCCCAAATCCGTTCCTAAACTAATTGCTTTCGAATCAGTATATTCTATGGCCGGTTCA GTGGCCGACATAGAAAAAATTTGCGACTTGGCCGACAAATACGGTGCTTTGACCTTCTTG GATGAAGTACATGCGGTCGGCCTGTACGGCCCTCACGGTGCAGGTGTTGCAGAACATTGT GATTTTGAAAGTCACCGTGCAAGTGGTATTGCTACCCCAAAGACCAATGACAAGGGCGGC GCGAAGACTGTGATGGACCGTGTCGACATGATCACCGGCACTTTAGGTAAGTCTTTCGGT AGCGTAGGTGGCTACGTCGCAGCCTCTAGGAAATTGATCGATTGGTTCAGATCGTTTGCA CCTGGTTTCATTTTCACCACGACTTTACCACCTTCAGTTATGGCAGGCGCTACCGCAGCA ATTAGATACCAACGTTGCCACATCGACCTAAGAACCTCGCAACAGAAACATACCATGTAC GTAAAGAAAGCTTTCCATGAGTTGGGCATTCCAGTTATTCCAAATCCTTCTCATATCGTC CCAGTGTTGATTGGTAATGCTGATTTGGCTAAGCAAGCTTCTGACATCTTAATCAATAAG CATCAAATCTACGTACAAGCTATCAACTTCCCTACGGTTGCTCGCGGTACCGAAAGATTG AGAATTACCCCAACGCCAGGTCACACCAACGATTTATCTGACATCTTAATCAATGCAGTT GATGATGTGTTCAATGAGCTACAGTTACCACGTGTCAGAGACTGGGAAAGCCAAGGTGGC TTATTGGGTGTTGGAGAGAGCGGATTTGTGGAAGAGTCTAACTTATGGACATCAAGCCAA CTATCTTTAACTAATGACGACTTGAACCCTAATGTTAGAGACCCCATCGTTAAACAACTA GAGGTTTCTAGTGGTATCAAGCAGTAA
Protein Properties
Pfam Domain Function
Protein Residues548
Protein Molecular Weight59361.69922
Protein Theoretical pI7.56
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>5-aminolevulinate synthase, mitochondrial MQRSIFARFGNSSAAVSTLNRLSTTAAPHAKNGYATATGAGAAAATATASSTHAAAAAAA AANHSTQESGFDYEGLIDSELQKKRLDKSYRYFNNINRLAKEFPLAHRQREADKVTVWCS NDYLALSKHPEVLDAMHKTIDKYGCGAGGTRNIAGHNIPTLNLEAELATLHKKEGALVFS SCYVANDAVLSLLGQKMKDLVIFSDELNHASMIVGIKHANVKKHIFKHNDLNELEQLLQS YPKSVPKLIAFESVYSMAGSVADIEKICDLADKYGALTFLDEVHAVGLYGPHGAGVAEHC DFESHRASGIATPKTNDKGGAKTVMDRVDMITGTLGKSFGSVGGYVAASRKLIDWFRSFA PGFIFTTTLPPSVMAGATAAIRYQRCHIDLRTSQQKHTMYVKKAFHELGIPVIPNPSHIV PVLIGNADLAKQASDILINKHQIYVQAINFPTVARGTERLRITPTPGHTNDLSDILINAV DDVFNELQLPRVRDWESQGGLLGVGESGFVEESNLWTSSQLSLTNDDLNPNVRDPIVKQL EVSSGIKQ
References
External Links
ResourceLink
Saccharomyces Genome Database HEM1
Uniprot IDP09950
Uniprot NameHEM1_YEAST
GenBank Gene IDM26329
Genebank Protein ID171662
General Reference
  • Urban-Grimal, D., Volland, C., Garnier, T., Dehoux, P., Labbe-Bois, R. (1986). "The nucleotide sequence of the HEM1 gene and evidence for a precursor form of the mitochondrial 5-aminolevulinate synthase in Saccharomyces cerevisiae." Eur J Biochem 156:511-519.3516694
  • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867
  • Keng, T., Guarente, L. (1987). "Constitutive expression of the yeast HEM1 gene is actually a composite of activation and repression." Proc Natl Acad Sci U S A 84:9113-9117.3321068
  • Keng, T., Alani, E., Guarente, L. (1986). "The nine amino-terminal residues of delta-aminolevulinate synthase direct beta-galactosidase into the mitochondrial matrix." Mol Cell Biol 6:355-364.3023841
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106