You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameRibonucleoside-diphosphate reductase small chain 1
Synonyms
  • Ribonucleotide reductase R2 subunit 1
  • Ribonucleotide reductase small subunit 1
Gene NameRNR2
Enzyme Class
Biological Properties
General FunctionInvolved in oxidoreductase activity
Specific FunctionProvides the precursors necessary for DNA synthesis. Catalyzes the biosynthesis of deoxyribonucleotides from the corresponding ribonucleotides. RNR2 provides the diiron-tyrosyl radical center
Cellular LocationNucleus.
SMPDB Pathways
Glutathione metabolismPW002395 ThumbThumb?image type=greyscaleThumb?image type=simple
Pyrimidine metabolismPW002469 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Glutathione metabolismec00480 Map00480
Purine metabolismec00230 Map00230
Pyrimidine metabolismec00240 Map00240
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00064CDPShow
YMDB00257Guanosine diphosphateShow
YMDB00307Uridine 5'-diphosphateShow
YMDB00746dUDPShow
YMDB00890waterShow
YMDB00898dGDPShow
YMDB00901dADPShow
YMDB00914ADPShow
YMDB00916dCDPShow
GO Classification
Component
Not Available
Function
binding
ion binding
cation binding
metal ion binding
transition metal ion binding
oxidoreductase activity
catalytic activity
oxidoreductase activity, acting on CH or CH2 groups
oxidoreductase activity, acting on CH or CH2 groups, disulfide as acceptor
ribonucleoside-diphosphate reductase activity
Process
oxidation reduction
nucleoside diphosphate metabolic process
metabolic process
nitrogen compound metabolic process
cellular nitrogen compound metabolic process
nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
deoxyribonucleoside diphosphate metabolic process
nucleobase, nucleoside and nucleotide metabolic process
nucleoside phosphate metabolic process
nucleotide metabolic process
Gene Properties
Chromosome Locationchromosome 10
LocusYJL026W
Gene Sequence>1200 bp ATGCCTAAAGAGACCCCTTCCAAAGCTGCTGCCGATGCATTGTCCGACTTGGAAATCAAA GATTCCAAGTCCAACCTTAACAAGGAATTGGAGACATTGAGAGAGGAAAACAGAGTAAAG TCAGACATGCTTAAGGAGAAATTGAGCAAGGACGCTGAAAATCACAAGGCTTACTTGAAA TCTCATCAAGTTCACCGTCACAAACTTAAGGAAATGGAAAAGGAGGAACCTTTGTTGAAT GAAGACAAGGAGAGAACTGTTCTTTTCCCTATCAAGTACCATGAAATCTGGCAAGCCTAC GAAGCTTCTTTCTGGACCGCTGAAACCGCTGAAGAAATTGATTTGTCTAAGGATATCCAT GACTGGAACAACAGAATGAACGAAAACGAGAGATTTTTCATTTCCAGAGTTCTTGCCTTT TTCGCCGCTTCTGACGGTATTGTTAATGAAAACTTGGTTGAAAACTTCTCCACCGAAGTC CAAATTCCAGAGGCAAAGAGTTTCTACGGTTTCCAAATCATGATTGAAAATATTCACTCT GAAACTTACTCCTTGTTGATCGATACTTACATCAAGGACCCTAAAGAAAGTGAATTCTTG TTCAATGCCATTCACACCATCCCAGAAATCGGTGAGAAGGCCGAATGGGCTTTAAGATGG ATTCAAGACGCTGACGCCTTGTTTGGTGAAAGACTAGTTGCCTTTGCCTCCATTGAAGGT GTCTTTTTCTCCGGTTCCTTTGCCTCCATTTTCTGGTTGAAAAAGAGAGGTATGATGCCC GGTTTAACCTTTTCCAACGAATTGATCTGTAGAGACGAAGGTTTGCACACCGACTTTGCA TGCTTGTTGTTCGCCCATTTGAAGAACAAACCAGACCCAGCCATTGTTGAAAAAATTGTC ACCGAGGCTGTGGAAATTGAACAAAGATACTTCTTGGACGCCTTACCAGTTGCTTTGCTA GGTATGAACGCTGACTTAATGAACCAATACGTTGAGTTCGTCGCCGACAGACTGTTGGTT GCTTTCGGTAACAAGAAATACTACAAGGTCGAAAACCCCTTCGATTTCATGGAAAACATC TCCTTGGCCGGTAAGACCAACTTCTTCGAAAAGAGAGTTTCTGACTACCAAAAGGCTGGT GTTATGTCCAAGTCGACTAAGCAAGAAGCCGGTGCTTTCACCTTCAACGAAGACTTTTAA
Protein Properties
Pfam Domain Function
Protein Residues399
Protein Molecular Weight46147.0
Protein Theoretical pI4.9
PDB Fileshow
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Ribonucleoside-diphosphate reductase small chain 1 MPKETPSKAAADALSDLEIKDSKSNLNKELETLREENRVKSDMLKEKLSKDAENHKAYLK SHQVHRHKLKEMEKEEPLLNEDKERTVLFPIKYHEIWQAYKRAEASFWTAEEIDLSKDIH DWNNRMNENERFFISRVLAFFAASDGIVNENLVENFSTEVQIPEAKSFYGFQIMIENIHS ETYSLLIDTYIKDPKESEFLFNAIHTIPEIGEKAEWALRWIQDADALFGERLVAFASIEG VFFSGSFASIFWLKKRGMMPGLTFSNELICRDEGLHTDFACLLFAHLKNKPDPAIVEKIV TEAVEIEQRYFLDALPVALLGMNADLMNQYVEFVADRLLVAFGNKKYYKVENPFDFMENI SLAGKTNFFEKRVSDYQKAGVMSKSTKQEAGAFTFNEDF
References
External Links
ResourceLink
Saccharomyces Genome Database RNR2
Uniprot IDP09938
Uniprot NameRIR2_YEAST
GenBank Gene IDM17221
Genebank Protein ID172448
PDB ID
1SMQ
General Reference
  • Elledge, S. J., Davis, R. W. (1987). "Identification and isolation of the gene encoding the small subunit of ribonucleotide reductase from Saccharomyces cerevisiae: DNA damage-inducible gene required for mitotic viability." Mol Cell Biol 7:2783-2793.3313004
  • Hurd, H. K., Roberts, C. W., Roberts, J. W. (1987). "Identification of the gene for the yeast ribonucleotide reductase small subunit and its inducibility by methyl methanesulfonate." Mol Cell Biol 7:3673-3677.3316984
  • Galibert, F., Alexandraki, D., Baur, A., Boles, E., Chalwatzis, N., Chuat, J. C., Coster, F., Cziepluch, C., De Haan, M., Domdey, H., Durand, P., Entian, K. D., Gatius, M., Goffeau, A., Grivell, L. A., Hennemann, A., Herbert, C. J., Heumann, K., Hilger, F., Hollenberg, C. P., Huang, M. E., Jacq, C., Jauniaux, J. C., Katsoulou, C., Karpfinger-Hartl, L., et, a. l. .. (1996). "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome X." EMBO J 15:2031-2049.8641269
  • Nguyen, H. H., Ge, J., Perlstein, D. L., Stubbe, J. (1999). "Purification of ribonucleotide reductase subunits Y1, Y2, Y3, and Y4 from yeast: Y4 plays a key role in diiron cluster assembly." Proc Natl Acad Sci U S A 96:12339-12344.10535923
  • Chabes, A., Domkin, V., Larsson, G., Liu, A., Graslund, A., Wijmenga, S., Thelander, L. (2000). "Yeast ribonucleotide reductase has a heterodimeric iron-radical-containing subunit." Proc Natl Acad Sci U S A 97:2474-2479.10716984
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Yao, R., Zhang, Z., An, X., Bucci, B., Perlstein, D. L., Stubbe, J., Huang, M. (2003). "Subcellular localization of yeast ribonucleotide reductase regulated by the DNA replication and damage checkpoint pathways." Proc Natl Acad Sci U S A 100:6628-6633.12732713
  • Peng, J., Schwartz, D., Elias, J. E., Thoreen, C. C., Cheng, D., Marsischky, G., Roelofs, J., Finley, D., Gygi, S. P. (2003). "A proteomics approach to understanding protein ubiquitination." Nat Biotechnol 21:921-926.12872131
  • Gruhler, A., Olsen, J. V., Mohammed, S., Mortensen, P., Faergeman, N. J., Mann, M., Jensen, O. N. (2005). "Quantitative phosphoproteomics applied to the yeast pheromone signaling pathway." Mol Cell Proteomics 4:310-327.15665377
  • Li, X., Gerber, S. A., Rudner, A. D., Beausoleil, S. A., Haas, W., Villen, J., Elias, J. E., Gygi, S. P. (2007). "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae." J Proteome Res 6:1190-1197.17330950
  • Chi, A., Huttenhower, C., Geer, L. Y., Coon, J. J., Syka, J. E., Bai, D. L., Shabanowitz, J., Burke, D. J., Troyanskaya, O. G., Hunt, D. F. (2007). "Analysis of phosphorylation sites on proteins from Saccharomyces cerevisiae by electron transfer dissociation (ETD) mass spectrometry." Proc Natl Acad Sci U S A 104:2193-2198.17287358
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Lee, Y. D., Wang, J., Stubbe, J., Elledge, S. J. (2008). "Dif1 is a DNA-damage-regulated facilitator of nuclear import for ribonucleotide reductase." Mol Cell 32:70-80.18851834
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956
  • Voegtli, W. C., Ge, J., Perlstein, D. L., Stubbe, J., Rosenzweig, A. C. (2001). "Structure of the yeast ribonucleotide reductase Y2Y4 heterodimer." Proc Natl Acad Sci U S A 98:10073-10078.11526233
  • Sommerhalter, M., Voegtli, W. C., Perlstein, D. L., Ge, J., Stubbe, J., Rosenzweig, A. C. (2004). "Structures of the yeast ribonucleotide reductase Rnr2 and Rnr4 homodimers." Biochemistry 43:7736-7742.15196016