You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameIsoleucyl-tRNA synthetase, cytoplasmic
Synonyms
  • Isoleucine--tRNA ligase
  • IleRS
Gene NameILS1
Enzyme Class
Biological Properties
General FunctionInvolved in nucleotide binding
Specific FunctionATP + L-isoleucine + tRNA(Ile) = AMP + diphosphate + L-isoleucyl-tRNA(Ile)
Cellular LocationCytoplasm
SMPDB PathwaysNot Available
KEGG Pathways
Valine, leucine and isoleucine biosynthesisec00290 Map00290
SMPDB ReactionsNot Available
KEGG Reactions
Adenosine triphosphate + tRNA(Ile) + L-IsoleucineAdenosine monophosphate + Pyrophosphate + Ile-tRNA(Ile)
Metabolites
YMDB IDNameView
YMDB00038L-IsoleucineShow
YMDB00097Adenosine monophosphateShow
YMDB00109Adenosine triphosphateShow
YMDB00219PyrophosphateShow
GO Classification
Component
intracellular part
cytoplasm
cell part
Function
ligase activity, forming carbon-oxygen bonds
ligase activity
ligase activity, forming aminoacyl-tRNA and related compounds
aminoacyl-tRNA ligase activity
isoleucine-tRNA ligase activity
binding
nucleotide binding
nucleoside binding
purine nucleoside binding
catalytic activity
adenyl nucleotide binding
adenyl ribonucleotide binding
ATP binding
Process
cellular macromolecule biosynthetic process
translation
biosynthetic process
isoleucyl-tRNA aminoacylation
cellular macromolecule metabolic process
RNA metabolic process
ncRNA metabolic process
tRNA metabolic process
tRNA aminoacylation
metabolic process
tRNA aminoacylation for protein translation
macromolecule metabolic process
macromolecule biosynthetic process
Gene Properties
Chromosome Locationchromosome 2
LocusYBL076C
Gene Sequence>3219 bp ATGTCCGAGAGTAACGCACACTTCTCATTTCCAAAGGAGGAAGAAAAAGTTCTATCTCTT TGGGATGAAATAGATGCCTTTCATACTTCATTAGAATTAACAAAAGACAAACCGGAGTTT TCCTTCTTCGATGGGCCTCCATTTGCCACCGGTACTCCTCATTACGGTCATATTCTTGCT TCCACTATTAAGGATATTGTTCCAAGATACGCTACCATGACAGGCCACCACGTGGAAAGA AGATTCGGTTGGGATACACACGGTGTTCCAATTGAACATATCATTGACAAGAAATTAGGT ATCACGGGTAAAGATGATGTCTTCAAGTATGGTCTTGAAAACTACAACAATGAGTGTAGA TCCATTGTTATGACTTATGCCAGTGATTGGAGAAAAACTATTGGTCGTTTGGGTCGTTGG ATTGATTTCGACAACGATTACAAGACTATGTATCCATCCTTTATGGAGTCCACATGGTGG GCTTTCAAGCAACTTCATGAAAAAGGTCAAGTTTACCGTGGATTCAAAGTTATGCCTTAT TCTACTGGGCTAACCACTCCCTTAAGTAACTTTGAAGCTCAGCAAAACTATAAAGATGTC AATGACCCAGCTGTGACCATTGGTTTCAATGTTATTGGCCAGGAAAAAACTCAATTGGTC GCATGGACTACGACTCCATGGACTTTACCTTCCAATTTGTCGTTATGTGTTAACGCTGAT TTCGAATATGTAAAGATTTACGACGAAACCAGAGATCGTTATTTCATCTTATTAGAATCT TTGATTAAAACCTTGTATAAGAAGCCTAAGAATGAAAAATATAAGATTGTGGAAAAAATT AAAGGTTCTGATTTGGTTGGTTTGAAGTATGAACCATTGTTCCCATATTTCGCTGAACAG TTCCATGAAACAGCTTTTAGAGTTATTTCAGATGATTATGTTACTAGTGATTCCGGTACT GGTATTGTTCATAACGCTCCCGCTTTCGGTGAAGAGGATAATGCTGCTTGTTTGAAGAAC GGCGTCATATCCGAAGATTCAGTGTTACCTAACGCCATTGATGACCTTGGTAGATTCACG AAAGACGTTCCTGATTTTGAGGGTGTTTATGTCAAGGACGCTGATAAGTTGATTATTAAG TACTTAACTAATACTGGAAATTTGTTATTGGCATCCCAAATTCGCCATTCCTATCCATTC TGTTGGAGATCCGATACCCCATTGTTATACCGTTCTGTTCCAGCTTGGTTCGTTCGTGTT AAAAACATTGTCCCTCAAATGTTGGATTCTGTGATGAAATCTCACTGGGTTCCTAACACC ATCAAGGAAAAGAGGTTCGCCAACTGGATCGCCAATGCCCGTGACTGGAACGTTTCCAGA AATAGATATTGGGGTACTCCAATTCCTTTATGGGTTTCAGACGATTTTGAGGAGGTCGTC TGTGTTGGTTCTATCAAAGAATTGGAAGAATTGACCGGTGTGCGTAACATCACTGACTTG CATCGTGATGTCATTGACAAATTGACAATTCCATCCAAGCAAGGTAAGGGTGACTTAAAG AGAATTGAAGAAGTTTTTGATTGTTGGTTTGAATCTGGTTCTATGCCTTATGCTTCTCAA CATTATCCATTTGAAAACACAGAAAAATTTGACGAAAGAGTTCCAGCTAATTTCATCTCT GAAGGTTTAGATCAAACAAGAGGTTGGTTCTACACGTTAGCTGTCTTAGGTACCCATCTA TTTGGCTCTGTTCCATACAAGAACGTCATCGTCTCTGGTATTGTCTTAGCTGCCGATGGT AGAAAGATGTCTAAATCCTTGAAAAATTACCCTGATCCATCCATTGTTCTGAACAAATAT GGTGCGGATGCATTAAGATTGTACTTGATAAACTCACCTGTTTTAAAAGCTGAAAGTTTG AAATTCAAAGAAGAGGGTGTTAAGGAGGTTGTTTCAAAGGTCTTACTACCATGGTGGAAC TCCTTTAAATTTTTGGACGGTCAAATTGCCTTGTTGAAAAAGATGTCTAACATCGACTTC CAATATGATGATTCTGTGAAAAGTGATAATGTCATGGACAGATGGATTTTAGCTTCTATG CAATCTCTAGTACAATTCATTCACGAAGAAATGGGTCAGTACAAATTATACACTGTCGTT CCAAAACTTTTGAACTTCATTGATGAATTGACAAACTGGTATATTAGATTTAATCGTCGT CGTTTGAAGGGTGAAAACGGTGTTGAGGACTGTTTGAAAGCATTGAATTCTTTATTCGAT GCCTTATTCACATTTGTCCGTGCCATGGCTCCATTCACCCCATTTTTGTCAGAAAGCATT TATTTGAGACTGAAGGAATACATCCCAGAAGCTGTCTTAGCAAAATACGGTAAGGACGGA AGATCAGTCCATTTCTTATCTTACCCAGTGGTCAAAAAAGAATACTTTGACGAGGCCATC GAAACTGCAGTTTCTAGAATGCAATCCGTTATCGATTTGGGTAGAAACATTCGTGAAAAG AAAACTATTTCCTTAAAAACTCCATTGAAGACTTTGGTCATCCTTCACAGTGATGAATCA TACTTGAAGGATGTAGAAGCCTTGAAGAACTACATTATCGAGGAATTAAATGTTCGTGAT GTTGTTATCACCTCCGATGAGGCAAAATATGGTGTTGAGTATAAAGCAGTTGCTGATTGG CCTGTATTGGGTAAGAAGTTGAAAAAAGACGCAAAGAAGGTTAAAGATGCCCTACCATCA GTCACTTCTGAGCAAGTACGGGAATATTTGGAAAGCGGAAAGTTGGAGGTTGCCGGTATT GAACTGGTTAAAGGAGATTTGAATGCTATTAGAGGCTTGCCAGAATCTGCTGTCCAAGCT GGACAAGAAACCAGAACCGACCAAGACGTGTTAATCATCATGGATACAAATATTTACTCT GAACTAAAGAGTGAAGGTCTCGCAAGAGAGCTGGTCAACAGAATCCAAAAATTGAGAAAG AAGTGTGGTTTGGAAGCCACCGACGATGTTTTAGTGGAGTACGAATTAGTTAAAGATACT ATCGACTTTGAAGCCATTGTCAAAGAACATTTTGATATGTTAAGCAAGACCTGTAGATCC GACATCGCCAAATATGACGGCTCAAAGACAGACCCAATTGGTGATGAAGAACAATCTATT AATGACACCATTTTCAAATTAAAAGTGTTCAAATTATGA
Protein Properties
Pfam Domain Function
Protein Residues1072
Protein Molecular Weight122982.0
Protein Theoretical pI5.9
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Isoleucyl-tRNA synthetase, cytoplasmic MSESNAHFSFPKEEEKVLSLWDEIDAFHTSLELTKDKPEFSFFDGPPFATGTPHYGHILA STIKDIVPRYATMTGHHVERRFGWDTHGVPIEHIIDKKLGITGKDDVFKYGLENYNNECR SIVMTYASDWRKTIGRLGRWIDFDNDYKTMYPSFMESTWWAFKQLHEKGQVYRGFKVMPY STGLTTPLSNFEAQQNYKDVNDPAVTIGFNVIGQEKTQLVAWTTTPWTLPSNLSLCVNAD FEYVKIYDETRDRYFILLESLIKTLYKKPKNEKYKIVEKIKGSDLVGLKYEPLFPYFAEQ FHETAFRVISDDYVTSDSGTGIVHNAPAFGEEDNAACLKNGVISEDSVLPNAIDDLGRFT KDVPDFEGVYVKDADKLIIKYLTNTGNLLLASQIRHSYPFCWRSDTPLLYRSVPAWFVRV KNIVPQMLDSVMKSHWVPNTIKEKRFANWIANARDWNVSRNRYWGTPIPLWVSDDFEEVV CVGSIKELEELTGVRNITDLHRDVIDKLTIPSKQGKGDLKRIEEVFDCWFESGSMPYASQ HYPFENTEKFDERVPANFISEGLDQTRGWFYTLAVLGTHLFGSVPYKNVIVSGIVLAADG RKMSKSLKNYPDPSIVLNKYGADALRLYLINSPVLKAESLKFKEEGVKEVVSKVLLPWWN SFKFLDGQIALLKKMSNIDFQYDDSVKSDNVMDRWILASMQSLVQFIHEEMGQYKLYTVV PKLLNFIDELTNWYIRFNRRRLKGENGVEDCLKALNSLFDALFTFVRAMAPFTPFLSESI YLRLKEYIPEAVLAKYGKDGRSVHFLSYPVVKKEYFDEAIETAVSRMQSVIDLGRNIREK KTISLKTPLKTLVILHSDESYLKDVEALKNYIIEELNVRDVVITSDEAKYGVEYKAVADW PVLGKKLKKDAKKVKDALPSVTSEQVREYLESGKLEVAGIELVKGDLNAIRGLPESAVQA GQETRTDQDVLIIMDTNIYSELKSEGLARELVNRIQKLRKKCGLEATDDVLVEYELVKDT IDFEAIVKEHFDMLSKTCRSDIAKYDGSKTDPIGDEEQSINDTIFKLKVFKL
References
External Links
ResourceLink
Saccharomyces Genome Database ILS1
Uniprot IDP09436
Uniprot NameSYIC_YEAST
GenBank Gene IDX07886
Genebank Protein ID3820
General Reference
  • Martindale, D. W., Gu, Z. M., Csank, C. (1989). "Isolation and complete sequence of the yeast isoleucyl-tRNA synthetase gene (ILS1)." Curr Genet 15:99-106.2663194
  • Englisch, U., Englisch, S., Markmeyer, P., Schischkoff, J., Sternbach, H., Kratzin, H., Cramer, F. (1987). "Structure of the yeast isoleucyl-tRNA synthetase gene (ILS1). DNA-sequence, amino-acid sequence of proteolytic peptides of the enzyme and comparison of the structure to those of other known aminoacyl-tRNA synthetases." Biol Chem Hoppe Seyler 368:971-979.3311074
  • Obermaier, B., Gassenhuber, J., Piravandi, E., Domdey, H. (1995). "Sequence analysis of a 78.6 kb segment of the left end of Saccharomyces cerevisiae chromosome II." Yeast 11:1103-1112.7502586
  • Feldmann, H., Aigle, M., Aljinovic, G., Andre, B., Baclet, M. C., Barthe, C., Baur, A., Becam, A. M., Biteau, N., Boles, E., Brandt, T., Brendel, M., Bruckner, M., Bussereau, F., Christiansen, C., Contreras, R., Crouzet, M., Cziepluch, C., Demolis, N., Delaveau, T., Doignon, F., Domdey, H., Dusterhus, S., Dubois, E., Dujon, B., El Bakkoury, M., Entian, K. D., Feurmann, M., Fiers, W., Fobo, G. M., Fritz, C., Gassenhuber, H., Glandsdorff, N., Goffeau, A., Grivell, L. A., de Haan, M., Hein, C., Herbert, C. J., Hollenberg, C. P., Holmstrom, K., Jacq, C., Jacquet, M., Jauniaux, J. C., Jonniaux, J. L., Kallesoe, T., Kiesau, P., Kirchrath, L., Kotter, P., Korol, S., Liebl, S., Logghe, M., Lohan, A. J., Louis, E. J., Li, Z. Y., Maat, M. J., Mallet, L., Mannhaupt, G., Messenguy, F., Miosga, T., Molemans, F., Muller, S., Nasr, F., Obermaier, B., Perea, J., Pierard, A., Piravandi, E., Pohl, F. M., Pohl, T. M., Potier, S., Proft, M., Purnelle, B., Ramezani Rad, M., Rieger, M., Rose, M., Schaaff-Gerstenschlager, I., Scherens, B., Schwarzlose, C., Skala, J., Slonimski, P. P., Smits, P. H., Souciet, J. L., Steensma, H. Y., Stucka, R., Urrestarazu, A., van der Aart, Q. J., van Dyck, L., Vassarotti, A., Vetter, I., Vierendeels, F., Vissers, S., Wagner, G., de Wergifosse, P., Wolfe, K. H., Zagulski, M., Zimmermann, F. K., Mewes, H. W., Kleine, K. (1994). "Complete DNA sequence of yeast chromosome II." EMBO J 13:5795-5809.7813418
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956