You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameFructose-1,6-bisphosphatase
Synonyms
  • FBPase
  • D-fructose-1,6-bisphosphate 1-phosphohydrolase
Gene NameFBP1
Enzyme Class
Biological Properties
General FunctionInvolved in phosphoric ester hydrolase activity
Specific FunctionD-fructose 1,6-bisphosphate + H(2)O = D- fructose 6-phosphate + phosphate
Cellular LocationCytoplasmic
SMPDB PathwaysNot Available
KEGG Pathways
Fructose and mannose metabolismec00051 Map00051
Glycolysis / Gluconeogenesisec00010 Map00010
Methane metabolismec00680 Map00680
Pentose phosphate pathwayec00030 Map00030
SMPDB ReactionsNot Available
KEGG Reactions
water + Fructose 1,6-bisphosphateFructose 6-phosphate + phosphate
Metabolites
YMDB IDNameView
YMDB00078Fructose 6-phosphateShow
YMDB00108Fructose 1,6-bisphosphateShow
YMDB00687D-fructose 1,6-bisphosphateShow
YMDB00890waterShow
YMDB00907phosphateShow
GO Classification
Component
Not Available
Function
hydrolase activity
hydrolase activity, acting on ester bonds
phosphoric ester hydrolase activity
catalytic activity
Process
carbohydrate metabolic process
metabolic process
primary metabolic process
Gene Properties
Chromosome Locationchromosome 12
LocusYLR377C
Gene Sequence>1047 bp ATGCCAACTCTAGTAAATGGACCAAGAAGAGACTCTACCGAAGGGTTTGATACCGATATC ATCACTCTTCCTAGATTCATAATCGAGCACCAGAAGCAATTTAAGAACGCTACTGGTGAT TTCACATTAGTACTGAATGCCTTGCAATTCGCGTTCAAATTTGTATCTCACACCATCAGA CGTGCTGAATTGGTTAACTTGGTTGGGTTAGCAGGCGCTTCCAACTTCACTGGTGACCAG CAAAAGAAGTTGGACGTTCTAGGTGATGAAATATTTATCAATGCCATGAGGGCTAGTGGG ATCATCAAGGTCCTTGTATCTGAAGAACAGGAAGACTTGATCGTTTTTCCCACAAACACG GGCTCATACGCAGTGTGTTGTGATCCTATTGATGGCTCCTCAAATTTGGACGCCGGTGTC TCCGTTGGAACTATCGCGTCTATATTCAGACTGCTACCAGACTCATCAGGTACTATAAAC GACGTACTGAGATGTGGTAAAGAAATGGTAGCCGCTTGCTATGCCATGTACGGATCCTCT ACGCATCTAGTATTGACATTGGGTGATGGAGTTGATGGGTTTACCTTAGACACAAACTTG GGCGAATTCATCTTGACTCATCCTAACTTAAGAATTCCGCCTCAAAAGGCCATCTACTCA ATTAATGAAGGTAACACCCTCTACTGGAACGAGACTATAAGAACATTTATTGAGAAAGTC AAACAACCCCAAGCAGACAACAACAACAAGCCTTTCTCGGCTAGGTATGTTGGATCCATG GTTGCTGATGTTCACAGGACGTTTCTTTACGGTGGCCTTTTCGCATACCCTTGCGACAAG AAGAGCCCCAACGGAAAACTGAGGTTGCTTTATGAGGCCTTCCCAATGGCTTTCTTAATG GAACAAGCAGGGGGAAAAGCGGTCAACGATCGCGGAGAGAGAATCTTGGATTTGGTGCCA AGTCATATCCATGACAAATCTTCTATTTGGTTGGGTTCTTCAGGTGAAATTGACAAATTT TTAGACCATATTGGCAAGTCACAGTAG
Protein Properties
Pfam Domain Function
Protein Residues348
Protein Molecular Weight38262.19922
Protein Theoretical pI5.87
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Fructose-1,6-bisphosphatase MPTLVNGPRRDSTEGFDTDIITLPRFIIEHQKQFKNATGDFTLVLNALQFAFKFVSHTIR RAELVNLVGLAGASNFTGDQQKKLDVLGDEIFINAMRASGIIKVLVSEEQEDLIVFPTNT GSYAVCCDPIDGSSNLDAGVSVGTIASIFRLLPDSSGTINDVLRCGKEMVAACYAMYGSS THLVLTLGDGVDGFTLDTNLGEFILTHPNLRIPPQKAIYSINEGNTLYWNETIRTFIEKV KQPQADNNNKPFSARYVGSMVADVHRTFLYGGLFAYPCDKKSPNGKLRLLYEAFPMAFLM EQAGGKAVNDRGERILDLVPSHIHDKSSIWLGSSGEIDKFLDHIGKSQ
References
External Links
ResourceLink
Saccharomyces Genome Database FBP1
Uniprot IDP09201
Uniprot NameF16P_YEAST
GenBank Gene IDAY692816
Genebank Protein ID51013083
General Reference
  • Rogers, D. T., Hiller, E., Mitsock, L., Orr, E. (1988). "Characterization of the gene for fructose-1,6-bisphosphatase from Saccharomyces cerevisiae and Schizosaccharomyces pombe. Sequence, protein homology, and expression during growth on glucose." J Biol Chem 263:6051-6057.2834361
  • Entian, K. D., Vogel, R. F., Rose, M., Hofmann, L., Mecke, D. (1988). "Isolation and primary structure of the gene encoding fructose-1,6-bisphosphatase from Saccharomyces cerevisiae." FEBS Lett 236:195-200.2841162
  • Johnston, M., Hillier, L., Riles, L., Albermann, K., Andre, B., Ansorge, W., Benes, V., Bruckner, M., Delius, H., Dubois, E., Dusterhoft, A., Entian, K. D., Floeth, M., Goffeau, A., Hebling, U., Heumann, K., Heuss-Neitzel, D., Hilbert, H., Hilger, F., Kleine, K., Kotter, P., Louis, E. J., Messenguy, F., Mewes, H. W., Hoheisel, J. D., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XII." Nature 387:87-90.9169871
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Marcus, F., Gontero, B., Harrsch, P. B., Rittenhouse, J. (1986). "Amino acid sequence homology among fructose-1,6-bisphosphatases." Biochem Biophys Res Commun 135:374-381.3008716
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106