Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameAdenylate cyclase
Synonyms
  • ATP pyrophosphate-lyase
  • Adenylyl cyclase
Gene NameCYR1
Enzyme Class
Biological Properties
General FunctionInvolved in phosphorus-oxygen lyase activity
Specific FunctionPlays essential roles in regulation of cellular metabolism by catalyzing the synthesis of a second messenger, cAMP
Cellular LocationNot Available
SMPDB PathwaysNot Available
KEGG Pathways
Purine metabolismec00230 Map00230
SMPDB ReactionsNot Available
KEGG Reactions
Adenosine triphosphatePyrophosphate + 3',5'-cyclic AMP
Metabolites
YMDB IDNameView
YMDB000233',5'-cyclic AMPShow
YMDB00109Adenosine triphosphateShow
YMDB00219PyrophosphateShow
GO Classification
Component
Not Available
Function
lyase activity
binding
ion binding
cation binding
metal ion binding
magnesium ion binding
catalytic activity
protein binding
cyclase activity
adenylate cyclase activity
phosphorus-oxygen lyase activity
Process
nucleoside phosphate metabolic process
regulation of biological process
nucleotide metabolic process
regulation of cellular process
purine nucleotide metabolic process
signal transduction
purine nucleotide biosynthetic process
cAMP biosynthetic process
signaling
signaling pathway
intracellular signaling pathway
nucleoside monophosphate metabolic process
nucleoside monophosphate biosynthetic process
cyclic nucleotide biosynthetic process
metabolic process
nitrogen compound metabolic process
cellular nitrogen compound metabolic process
nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
nucleobase, nucleoside and nucleotide metabolic process
biological regulation
Gene Properties
Chromosome Locationchromosome 10
LocusYJL005W
Gene Sequence>6081 bp ATGTCATCAAAACCTGATACTGGTTCGGAAATTTCTGGCCCTCAGCGACAGGAAGAACAA GAACAACAGATAGAGCAGAGCTCACCTACGGAAGCAAACGATAGAAGCATTCATGATGAG GTACCAAAAGTGAAGAAGCGTCACGAACAAAATAGTGGTCACAAATCAAGAAGGAATAGC GCATATAGTTATTACAGCCCACGGTCGCTTTCTATGACCAAAAGCAGGGAGAGTATCACT CCAAATGGTATGGATGATGTAAGTATTTCGAACGTGGAACATCCAAGGCCGACAGAACCG AAAATCAAAAGGGGTCCATATTTACTGAAGAAAACATTGAGCAGTCTTTCAATGACGAGC GCGAATAGTACTCATGATGATAATAAAGACCACGGTTACGCTTTGAATTCATCCAAGACG CACAACTACACATCTACTCATAACCATCATGACGGTCATCATGATCATCATCATGTTCAG TTTTTTCCCAATAGGAAGCCATCATTAGCGGAAACCCTATTCAAAAGGTTTTCAGGGTCA AACAGTCACGATGGCAATAAGTCAGGAAAGGAAAGTAAAGTTGCTAACCTTTCCCTTTCA ACGGTAAATCCTGCACCTGCTAATAGGAAACCTTCTAAAGACTCCACTTTATCTAATCAC TTGGCTGATAACGTGCCAAGCACTTTACGAAGGAAAGTGTCCTCATTGGTACGTGGTTCT TCCGTCCATGATATAAATAATGGTATTGCAGATAAACAGATTAGACCAAAGGCTGTTGCG CAATTAGAAAATACATTACATTCATCTGATGTTCCCAATAGCAAACGCTCGCACAGAAAA AGCTTTCTGCTAGGCTCCACATCTTCTTCAAGCAGTAGAAGAGGTTCAAATGTCAGTTCA ATGACTAACAGTGACAGTGCAAGTATGGCGACGTCGGGTAGTCATGTTCTCCAACATAAC GTATCTAATGTTTCTCCAACTACTAAAAGTAAGGACAGCGTTAACAGCGAATCCGCCGAT CACACTAATAATAAATCCGAGAAAGTGACTCCAGAATATAATGAGAACATTCCGGAAAAT TCTAACTCTGACAACAAACGCGAAGCCACAACGCCTACTATAGAAACACCCATTTCATGT AAACCATCCCTTTTCAGGCTAGATACAAACCTTGAGGATGTTACTGATATTACAAAGACG GTGCCACCCACCGCTGTCAATTCTACACTAAATTCTACACACGGGACTGAGACTGCCTCA CCCAAAACGGTGATCATGCCTGAAGGTCCTAGGAAGTCGGTGTCAATGGCTGATCTCTCC GTCGCTGCCGCAGCACCTAATGGTGAATTCACATCAACTTCCAATGATAGATCACAATGG GTAGCACCTCAAAGCTGGGATGTGGAAACCAAAAGGAAAAAAACAAAACCTAAAGGGAGA TCGAAATCAAGAAGGTCAAGTATAGATGCTGATGAACTTGATCCCATGTCACCGGGGCCA CCTTCAAAAAAAGACTCTCGTCATCATCACGATCGAAAGGATAACGAATCAATGGTCACT GCGGGTGACAGTAACTCAAGTTTTGTTGATATATGTAAAGAAAACGTTCCGAATGATAGC AAGACCGCACTCGATACTAAACTTGTGAACCGCTTAAAAAGTAATTTGGCTATGAGTCCC CCAAGTATACGATATGCTCCATCAAATTTAGATGGGGACTACGACACGTCTTCCACTTCC TCATCTTTACCGTCCTCATCTATTAGTTCAGAACATACATCTTCCTGCAGCGATTCCTCT TCGTACACTAACGCGTATATGGAGGCCAACCGAGAGCAGGATAATAAAACACCGATCCTG AATAAAACGAAATCGTATACCAAGAAATTTACATCCTCTTCGGTAAATATGAATTCACCA GATGGTGCCCAGAGTTCTGGATTATTACTACAAGATGAGAAGGACGATGAGGTCGAGTGC CAACTGGAACATTACTATAAAGATTTCAGTGATTTAGATCCAAAGAGGCACTATGCTATT CGTATATTCAATACTGATGACACTTTTACGACTCTCTCATGTACTCCAGCGACTACCGTC GAAGAGATAATACCTGCACTTAAAATAAAATTTAACATTACAGCGCAAGGGAATTTTCAA ATTTCCCTGAAGGTGGGAAAGTTGTCAAAAATTTTGAGACCAACTTCGAAACCTATTTTA ATTGAAAGAAAACTTTTACTTTTGAATGGTTATCGAAAGTCAGACCCACTTCATATTATG GGTATAGAGGATTTAAGTTTTGTTTTTAAGTTTCTTTTCCATCCTGTCACACCTTCTCAC TTTACTCCTGAACAAGAACAAAGAATAATGAGAAGCGAATTTGTTCACGTAGATTTAAGG AATATGGATCTCACTACACCTCCCATCATTTTTTACCAGCATACGTCAGAAATAGAAAGT TTAGACGTTTCTAATAACGCAAATATATTCCTACCTCTGGAGTTCATTGAAAGCTCGATT AAATTATTAAGTTTGAGAATGGTTAATATTAGAGCATCTAAATTTCCTTCCAATATCACT AAGGCGTATAAACTAGTATCTTTGGAATTACAGAGAAACTTCATAAGAAAAGTACCGAAC TCAATCATGAAACTGAGTAATTTAACGATATTAAACCTTCAATGTAATGAGCTTGAAAGC CTACCGGCTGGATTTGTTGAACTGAAAAATCTGCAATTGCTAGACTTGTCTTCAAACAAG TTCATGCACTACCCAGAAGTTATTAACTACTGCACCAATCTTTTACAAATAGACCTATCA TATAATAAAATCCAAAGCTTACCACAGTCCACTAAGTACCTAGTAAAGCTTGCGAAGATG AACCCTTCTCATAACAAACTAAATTTTATAGGCGACTTATCGGAAATGACAGATTTGAGG ACGCTGAACCTAAGATATAACAGAATATCATCAATTAAGACAAATGCGTCTAACTTGCAG AACCTTTTTTTAACAGATAATAGAATTTCGAACTTTGAAGACACTTTGCCGAAACTAAGA GCCCTTGAAATTCAAGAGAATCCAATCACTTCTATATCCTTCAAAGATTTTTATCCAAAA AACATGACAAGTTTGACGTTGAACAAGGCACAGTTATCGAGTATTCCTGGAGAATTACTC ACCAAACTATCTTTCCTCGAGAAACTTGAACTTAATCAGAATAATTTGACTAGACTGCCA CAGGAGATATCCAAGTTGACTAAATTAGTTTTCCTTTCAGTGGCGAGAAACAAACTAGAG TATATTCCACCCGAGCTATCTCAACTGAAAAGTTTGAGGACATTAGATCTACATTCTAAC AACATAAGGGACTTTGTTGACGGTATGGAAAACCTTGAACTAACATCGCTAAATATTTCA TCGAATGCATTCGGTAACTCTAGCTTAGAAAATTCTTTTTACCATAACATGTCATATGGG TCAAAGTTATCTAAAAGCCTGATGTTTTTTATTGCTGCAGACAATCAATTTGATGATGCT ATGTGGCCTCTTTTCAATTGCTTTGTCAATCTGAAAGTGCTAAATCTTTCTTACAACAAT TTTTCAGATGTATCGCACATGAAACTTGAGAGCATTACCGAATTGTACCTCTCCGGTAAT AAGCTCACGACATTGTCGGGTGATACAGTTTTGAAATGGAGCTCTTTAAAGACTTTAATG TTGAATAGTAACCAAATGTTATCTCTGCCTGCAGAATTATCAAATCTCTCACAGCTAAGT GTATTTGATGTTGGAGCAAATCAATTAAAGTATAATATATCAAACTATCATTACGATTGG AACTGGAGGAATAATAAAGAACTAAAATATTTGAATTTTTCAGGAAATCGAAGGTTTGAA ATAAAGTCATTTATAAGTCACGATATTGATGCTGATTTGTCAGATCTGACAGTATTACCT CAGTTAAAGGTACTAGGTTTAATGGACGTAACTTTAAATACTACCAAAGTACCGGATGAA AATGTCAATTTCCGTTTAAGGACAACTGCATCAATAATAAATGGGATGCGCTACGGTGTT GCTGATACATTAGGTCAAAGAGACTATGTGTCATCTCGTGATGTTACCTTTGAAAGATTC CGCGGAAATGACGACGAATGCTCACTATGTCTTCATGATAGTAAAAACCAAAATGCAGAT TATGGCCACAATATATCAAGAATTGTTAGAGATATTTACGATAAAATACTGATCAGACAA CTGGAAAGGTATGGAGACGAAACAGATGATAATATAAAAACTGCACTTCGTTTCAGTTTT TTGCAACTGAATAAGGAGATTAACGGAATGCTAAATTCTGTTGATAATGGTGCCGATGTT GCCAATCTTTCATATGCAGACTTGCTAAGTGGCGCTTGCTCTACTGTGATATATATCAGA GGGAAGAAACTCTTCGCTGCAAATTTAGGTGACTGTATGGCTATTTTATCCAAAAACAAT GGTGACTACCAAACGCTAACCAAACAACATCTCCCAACAAAGCGGGAAGAATACGAGAGG ATCAGAATATCTGGCGGGTATGTCAACAATGGAAAATTAGATGGTGTTGTAGATGTGTCT AGAGCAGTGGGTTTTTTTGATTTGCTTCCCCACATTCATGCTTCTCCCGACATATCTGTC GTGACATTAACAAAATCAGACGAGATGCTTATTGTAGCAACGCATAAGTTATGGGAATAC ATGGACGTGGATACAGTTTGTGATATCGCGCGTGAGAATAGTACTGATCCACTCCGTGCC GCAGCTGAGTTGAAGGATCATGCCATGGCTTACGGCTGTACAGAGAATATTACAATTTTG TGCCTTGCTCTTTACGAGAACATTCAGCAACAAAATCGGTTCACTTTAAATAAAAACTCT TTAATGACTAGAAGAAGTACTTTCGAGGATACTACATTAAGAAGACTTCAACCTGAGATT TCTCCGCCAACAGGTAACCTAGCAATGGTCTTCACTGATATCAAAAGCTCAACCTTCTTA TGGGAGCTATTCCCTAACGCAATGAGGACCGCAATAAAAACTCACAATGACATTATGCGT CGTCAACTACGAATTTACGGTGGTTACGAAGTAAAGACAGAAGGAGACGCCTTTATGGTG GCATTTCCTACGCCAACTAGTGGTCTGACATGGTGCTTAAGTGGTCAATTAAAACTCTTG GATGCACAATGGCCGGAGGAAATTACCTCAGTTCAAGACGGCTGCCAAGTTACGGATAGA AATGGTAACATTATCTATCAAGGCCTATCAGTTAGAATGGGTATTCATTGGGGCTGCCCA GTTCCAGAGCTTGATTTAGTGACTCAAAGAATGGACTATTTGGGGCCGATGGTCAATAAG GCAGCAAGGGTCCAGGGCGTCGCTGACGGTGGTCAGATTGCAATGAGTAGTGATTTTTAC TCTGAATTCAACAAGATAATGAAGTATCATGAGCGAGTAGTGAAGGGCAAGGAATCTCTC AAGGAAGTTTATGGTGAAGAAATTATCGGAGAGGTTCTTGAAAGAGAAATTGCCATGCTG GAAAGTATTGGTTGGGCATTTTTTGACTTTGGCGAGCATAAGCTAAAGGGACTCGAAACC AAAGAACTCGTTACTATTGCGTATCCTAAGATTCTTGCTTCCAGACACGAATTTGCATCT GAAGATGAGCAGTCAAAATTAATCAATGAAACGATGTTGTTTCGTTTAAGAGTCATTTCA AACAGACTGGAATCTATAATGTCAGCTTTAAGCGGCGGATTTATTGAACTAGACTCTCGG ACGGAGGGAAGTTATATTAAATTTAACCCTAAAGTTGAAAATGGTATTATGCAATCGATT TCTGAGAAGGATGCGTTGTTATTTTTTGATCATGTAATTACTAGAATCGAATCCAGTGTG GCATTATTACATTTACGACAACAGAGGTGTTCAGGACTGGAAATTTTCAGAAACGATAAA ACATCTGCTCGAAGCAATATTTTCAATGTTGTTGACGAACTTTTACAAATGGTTAAGAAC GCAAAGGATTTATCAACTTGA
Protein Properties
Pfam Domain Function
Protein Residues2026
Protein Molecular Weight227832.0
Protein Theoretical pI7.32
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Adenylate cyclase MSSKPDTGSEISGPQRQEEQEQQIEQSSPTEANDRSIHDEVPKVKKRHEQNSGHKSRRNS AYSYYSPRSLSMTKSRESITPNGMDDVSISNVEHPRPTEPKIKRGPYLLKKTLSSLSMTS ANSTHDDNKDHGYALNSSKTHNYTSTHNHHDGHHDHHHVQFFPNRKPSLAETLFKRFSGS NSHDGNKSGKESKVANLSLSTVNPAPANRKPSKDSTLSNHLADNVPSTLRRKVSSLVRGS SVHDINNGIADKQIRPKAVAQSENTLHSSDVPNSKRSHRKSFLLGSTSSSSSRRGSNVSS MTNSDSASMATSGSHVLQHNVSNVSPTTKSKDSVNSESADHTNNKSEKVTPEYNENIPEN SNSDNKREATTPTIETPISCKPSLFRLDTNLEDVTDITKTVPPTAVNSTLNSTHGTETAS PKTVIMPEGPRKSVSMADLSVAAAAPNGEFTSTSNDRSQWVAPQSWDVETKRKKTKPKGR SKSRRSSIDADELDPMSPGPPSKKDSRHHHDRKDNESMVTAGDSNSSFVDICKENVPNDS KTALDTKSVNRLKSNLAMSPPSIRYAPSNLDGDYDTSSTSSSLPSSSISSEDTSSCSDSS SYTNAYMEANREQDNKTPILNKTKSYTKKFTSSSVNMNSPDGAQSSGLLLQDEKDDEVEC QLEHYYKDFSDLDPKRHYAIRIFNTDDTFTTLSCTPATTVEEIIPALKRKFNITAQGNFQ ISLKVGKLSKILRPTSKPILIERKLLLLNGYRKSDPLHIMGIEDLSFVFKFLFHPVTPSH FTPEQEQRIMRSEFVHVDLRNMDLTTPPIIFYQHTSEIESLDVSNNANIFLPLEFIESSI KLLSLRMVNIRASKFPSNITKAYKLVSLELQRNFIRKVPNSIMKLSNLTILNLQCNELES LPAGFVELKNLQLLDLSSNKFMHYPEVINYCTNLLQIDLSYNKIQSLPQSTKYLVKLAKM NLSHNKLNFIGDLSEMTDLRTLNLRYNRISSIKTNASNLQNLFLTDNRISNFEDTLPKLR ALEIQENPITSISFKDFYPKNMTSLTLNKAQLSSIPGELLTKLSFLEKLELNQNNLTRLP QEISKLTKLVFLSVARNKLEYIPPELSQLKSLRTLDLHSNNIRDFVDGMENLELTSLNIS SNAFGNSSLENSFYHNMSYGSKLSKSLMFFIAADNQFDDAMWPLFNCFVNLKVLNLSYNN FSDVSHMKLESITELYLSGNKLTTLSGDTVLKWSSLKTLMLNSNQMLSLPAELSNLSQLS VFDVGANQLKYNISNYHYDWNWRNNKELKYLNFSGNRRFEIKSFISHDIDADLSDLTVLP QLKVLGLMDVTLNTTKVPDENVNFRLRTTASIINGMRYGVADTLGQRDYVSSRDVTFERF RGNDDECLLCLHDSKNQNADYGHNISRIVRDIYDKILIRQLERYGDETDDNIKTALRFSF LQLNKEINGMLNSVDNGADVANLSYADLLSGACSTVIYIRGKKLFAANLGDCMAILSKNN GDYQTLTKQHLPTKREEYERIRISGGYVNNGKLDGVVDVSRAVGFFDLLPHIHASPDISV VTLTKADEMLIVATHKLWEYMDVDTVCDIARENSTDPLRAAAELKDHAMAYGCTENITIL CLALYENIQQQNRFTLNKNSLMTRRSTFEDTTLRRLQPEISPPTGNLAMVFTDIKSSTFL WELFPNAMRTAIKTHNDIMRRQLRIYGGYEVKTEGDAFMVAFPTPTSGLTWCLSVQLKLL DAQWPEEITSVQDGCQVTDRNGNIIYQGLSVRMGIHWGCPVPELDLVTQRMDYLGPMVNK AARVQGVADGGQIAMSSDFYSEFNKIMKYHERVVKGKESLKEVYGEEIIGEVLEREIAML ESIGWAFFDFGEHKLKGLETKELVTIAYPKILASRHEFASEDEQSKLINETMLFRLRVIS NRLESIMSALSGGFIELDSRTEGSYIKFNPKVENGIMQSISEKDALLFFDHVITRIESSV ALLHLRQQRCSGLEICRNDKTSARSNIFNVVDELLQMVKNAKDLST
References
External Links
ResourceLink
Saccharomyces Genome Database CYR1
Uniprot IDP08678
Uniprot NameCYAA_YEAST
GenBank Gene IDM12057
Genebank Protein ID171360
General Reference
  • Kataoka, T., Broek, D., Wigler, M. (1985). "DNA sequence and characterization of the S. cerevisiae gene encoding adenylate cyclase." Cell 43:493-505.2934138
  • Galibert, F., Alexandraki, D., Baur, A., Boles, E., Chalwatzis, N., Chuat, J. C., Coster, F., Cziepluch, C., De Haan, M., Domdey, H., Durand, P., Entian, K. D., Gatius, M., Goffeau, A., Grivell, L. A., Hennemann, A., Herbert, C. J., Heumann, K., Hilger, F., Hollenberg, C. P., Huang, M. E., Jacq, C., Jauniaux, J. C., Katsoulou, C., Karpfinger-Hartl, L., et, a. l. .. (1996). "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome X." EMBO J 15:2031-2049.8641269
  • Masson, P., Lenzen, G., Jacquemin, J. M., Danchin, A. (1986). "Yeast adenylate cyclase catalytic domain is carboxy terminal." Curr Genet 10:343-352.3327602
  • Feger, G., De Vendittis, E., Vitelli, A., Masturzo, P., Zahn, R., Verrotti, A. C., Kavounis, C., Pal, G. P., Fasano, O. (1991). "Identification of regulatory residues of the yeast adenylyl cyclase." EMBO J 10:349-359.1991451
  • Gruhler, A., Olsen, J. V., Mohammed, S., Mortensen, P., Faergeman, N. J., Mann, M., Jensen, O. N. (2005). "Quantitative phosphoproteomics applied to the yeast pheromone signaling pathway." Mol Cell Proteomics 4:310-327.15665377
  • Li, X., Gerber, S. A., Rudner, A. D., Beausoleil, S. A., Haas, W., Villen, J., Elias, J. E., Gygi, S. P. (2007). "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae." J Proteome Res 6:1190-1197.17330950
  • Chi, A., Huttenhower, C., Geer, L. Y., Coon, J. J., Syka, J. E., Bai, D. L., Shabanowitz, J., Burke, D. J., Troyanskaya, O. G., Hunt, D. F. (2007). "Analysis of phosphorylation sites on proteins from Saccharomyces cerevisiae by electron transfer dissociation (ETD) mass spectrometry." Proc Natl Acad Sci U S A 104:2193-2198.17287358
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956