You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePentafunctional AROM polypeptide
Synonyms
  • 3-dehydroquinate synthase
  • 3-phosphoshikimate 1-carboxyvinyltransferase
  • 5-enolpyruvylshikimate-3-phosphate synthase
  • EPSP synthase
  • EPSPS
  • Shikimate kinase
  • 3-dehydroquinate dehydratase
  • 3-dehydroquinase
  • Shikimate dehydrogenase
Gene NameARO1
Enzyme Class
Biological Properties
General FunctionInvolved in 3-dehydroquinate dehydratase activity
Specific FunctionThe AROM polypeptide catalyzes 5 consecutive enzymatic reactions in prechorismate polyaromatic amino acid biosynthesis
Cellular LocationCytoplasm
SMPDB PathwaysNot Available
KEGG Pathways
Phenylalanine, tyrosine and tryptophan biosynthesisec00400 Map00400
SMPDB ReactionsNot Available
KEGG Reactions
3-Dehydroquinatewater + 3-Dehydroshikimic acid
7-phospho-2-dehydro-3-deoxy-D-arabino-heptonic acid3-Dehydroquinate + phosphate
Phosphoenolpyruvic acid + 3-Phosphoshikimic acidphosphate + 5-O-(1-carboxyvinyl)-3-phosphoshikimic acid
NADPH + hydron + 3-Dehydroshikimic acidNADP + Shikimic acid
Adenosine triphosphate + Shikimic acid3-Phosphoshikimic acid + hydron + ADP
Metabolites
YMDB IDNameView
YMDB000317-phospho-2-dehydro-3-deoxy-D-arabino-heptonic acidShow
YMDB001003-DehydroquinateShow
YMDB00109Adenosine triphosphateShow
YMDB00216Shikimic acidShow
YMDB00276Phosphoenolpyruvic acidShow
YMDB003323-Phosphoshikimic acidShow
YMDB003615-O-(1-carboxyvinyl)-3-phosphoshikimic acidShow
YMDB003903-Dehydroshikimic acidShow
YMDB00426NADPHShow
YMDB00427NADPShow
YMDB004583-DehydroshikimateShow
YMDB00862hydronShow
YMDB00890waterShow
YMDB00907phosphateShow
YMDB00914ADPShow
GO Classification
Component
intracellular part
cytoplasm
cell part
Function
shikimate kinase activity
binding
shikimate 5-dehydrogenase activity
transferase activity, transferring alkyl or aryl (other than methyl) groups
nucleoside binding
3-phosphoshikimate 1-carboxyvinyltransferase activity
purine nucleoside binding
carbon-oxygen lyase activity, acting on phosphates
adenyl nucleotide binding
3-dehydroquinate synthase activity
adenyl ribonucleotide binding
3-dehydroquinate dehydratase activity
ATP binding
catalytic activity
oxidoreductase activity
transferase activity
kinase activity
oxidoreductase activity, acting on CH-OH group of donors
transferase activity, transferring phosphorus-containing groups
oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
lyase activity
carbon-oxygen lyase activity
hydro-lyase activity
Process
aromatic amino acid family biosynthetic process
oxidation reduction
metabolic process
cellular amino acid biosynthetic process
cellular metabolic process
cellular amino acid and derivative metabolic process
cellular amino acid metabolic process
Gene Properties
Chromosome Locationchromosome 4
LocusYDR127W
Gene Sequence>4767 bp ATGGTGCAGTTAGCCAAAGTCCCAATTCTAGGAAATGATATTATCCACGTTGGGTATAAC ATTCATGACCATTTGGTTGAAACCATAATTAAACATTGTCCTTCTTCGACATACGTTATT TGCAATGATACGAACTTGAGTAAAGTTCCATACTACCAGCAATTAGTCCTGGAATTCAAG GCTTCTTTGCCAGAAGGCTCTCGTTTACTTACTTATGTTGTTAAACCAGGTGAGACAAGT AAAAGTAGAGAAACCAAAGCGCAGCTAGAAGATTATCTTTTAGTGGAAGGATGTACTCGT GATACGGTTATGGTAGCGATCGGTGGTGGTGTTATTGGTGACATGATTGGGTTCGTTGCA TCTACATTTATGAGAGGTGTTCGTGTTGTCCAAGTACCAACATCCTTATTGGCAATGGTC GATTCCTCCATTGGTGGTAAAACTGCTATTGACACTCCTCTAGGTAAAAACTTTATTGGT GCATTTTGGCAACCAAAATTTGTCCTTGTAGATATTAAATGGCTAGAAACGTTAGCCAAG AGAGAGTTTATCAATGGGATGGCAGAAGTTATCAAGACTGCTTGTATTTGGAACGCTGAC GAATTTACTAGATTAGAATCAAACGCTTCGTTGTTCTTAAATGTTGTTAATGGGGCAAAA AATGTCAAGGTTACCAATCAATTGACAAACGAGATTGACGAGATATCGAATACAGATATT GAAGCTATGTTGGATCATACATATAAGTTAGTTCTTGAGAGTATTAAGGTCAAAGCGGAA GTTGTCTCTTCGGATGAACGTGAATCCAGTCTAAGAAACCTTTTGAACTTCGGACATTCT ATTGGTCATGCTTATGAAGCTATACTAACCCCACAAGCATTACATGGTGAATGTGTGTCC ATTGGTATGGTTAAAGAGGCGGAATTATCCCGTTATTTCGGTATTCTCTCCCCTACCCAA GTTGCACGTCTATCCAAGATTTTGGTTGCCTACGGGTTGCCTGTTTCGCCTGATGAGAAA TGGTTTAAAGAGCTAACCTTACATAAGAAAACACCATTGGATATCTTATTGAAGAAAATG AGTATTGACAAGAAAAACGAGGGTTCCAAAAAGAAGGTGGTCATTTTAGAAAGTATTGGT AAGTGCTATGGTGACTCCGCTCAATTTGTTAGCGATGAAGACCTGAGATTTATTCTAACA GATGAAACCCTCGTTTACCCCTTCAAGGACATCCCTGCTGATCAACAGAAAGTTGTTATC CCCCCTGGTTCTAAGTCCATCTCCAATCGTGCTTTAATTCTTGCTGCCCTCGGTGAAGGT CAATGTAAAATCAAGAACTTATTACATTCTGATGATACTAAACATATGTTAACCGCTGTT CATGAATTGAAAGGTGCTACGATATCATGGGAAGATAATGGTGAGACGGTAGTGGTGGAA GGACATGGTGGTTCCACATTGTCAGCTTGTGCTGACCCCTTATATCTAGGTAATGCAGGT ACTGCATCTAGATTTTTGACTTCCTTGGCTGCCTTGGTCAATTCTACTTCAAGCCAAAAG TATATCGTTTTAACTGGTAACGCAAGAATGCAACAAAGACCAATTGCTCCTTTGGTCGAT TCTTTGCGTGCTAATGGTACTAAAATTGAGTACTTGAATAATGAAGGTTCCCTGCCAATC AAAGTTTATACTGATTCGGTATTCAAAGGTGGTAGAATTGAATTAGCTGCTACAGTTTCT TCTCAGTACGTATCCTCTATCTTGATGTGTGCCCCATACGCTGAAGAACCTGTAACTTTG GCTCTTGTTGGTGGTAAGCCAATCTCTAAATTGTACGTCGATATGACAATAAAAATGATG GAAAAATTCGGTATCAATGTTGAAACTTCTACTACAGAACCTTACACTTATTATATTCCA AAGGGACATTATATTAACCCATCAGAATACGTCATTGAAAGTGATGCCTCAAGTGCTACA TACCCATTGGCCTTCGCCGCAATGACTGGTACTACCGTAACGGTTCCAAACATTGGTTTT GAGTCGTTACAAGGTGATGCCAGATTTGCAAGAGATGTCTTGAAACCTATGGGTTGTAAA ATAACTCAAACGGCAACTTCAACTACTGTTTCGGGTCCTCCTGTAGGTACTTTAAAGCCA TTAAAACATGTTGATATGGAGCCAATGACTGATGCGTTCTTAACTGCATGTGTTGTTGCC GCTATTTCGCACGACAGTGATCCAAATTCTGCAAATACAACCACCATTGAAGGTATTGCA AACCAGCGTGTCAAAGAGTGTAACAGAATTTTGGCCATGGCTACAGAGCTCGCCAAATTT GGCGTCAAAACTACAGAATTACCAGATGGTATTCAAGTCCATGGTTTAAACTCGATAAAA GATTTGAAGGTTCCTTCCGACTCTTCTGGACCTGTCGGTGTATGCACATATGATGATCAT CGTGTGGCCATGAGTTTCTCGCTTCTTGCAGGAATGGTAAATTCTCAAAATGAACGTGAC GAAGTTGCTAATCCTGTAAGAATACTTGAAAGACATTGTACTGGTAAAACCTGGCCTGGC TGGTGGGATGTGTTACATTCCGAACTAGGTGCCAAATTAGATGGTGCAGAACCTTTAGAG TGCACATCCAAAAAGAACTCAAAGAAAAGCGTTGTCATTATTGGCATGAGAGCAGCTGGC AAAACTACTATAAGTAAATGGTGCGCATCCGCTCTGGGTTACAAATTAGTTGACCTAGAC GAGCTGTTTGAGCAACAGCATAACAATCAAAGTGTTAAACAATTTGTTGTGGAGAACGGT TGGGAGAAGTTCCGTGAGGAAGAAACAAGAATTTTCAAGGAAGTTATTCAAAATTACGGC GATGATGGATATGTTTTCTCAACAGGTGGCGGTATTGTTGAAAGCGCTGAGTCTAGAAAA GCCTTAAAAGATTTTGCCTCATCAGGTGGATACGTTTTACACTTACATAGGGATATTGAG GAGACAATTGTCTTTTTACAAAGTGATCCTTCAAGACCTGCCTATGTGGAAGAAATTCGT GAAGTTTGGAACAGAAGGGAGGGGTGGTATAAAGAATGCTCAAATTTCTCTTTCTTTGCT CCTCATTGCTCCGCAGAAGCTGAGTTCCAAGCTCTAAGAAGATCGTTTAGTAAGTACATT GCAACCATTACAGGTGTCAGAGAAATAGAAATTCCAAGCGGAAGATCTGCCTTTGTGTGT TTAACCTTTGATGACTTAACTGAACAAACTGAGAATTTGACTCCAATCTGTTATGGTTGT GAGGCTGTAGAGGTCAGAGTAGACCATTTGGCTAATTACTCTGCTGATTTCGTGAGTAAA CAGTTATCTATATTGCGTAAAGCCACTGACAGTATTCCTATCATTTTTACTGTGCGAACC ATGAAGCAAGGTGGCAACTTTCCTGATGAAGAGTTCAAAACCTTGAGAGAGCTATACGAT ATTGCCTTGAAGAATGGTGTTGAATTCCTTGACTTAGAACTAACTTTACCTACTGATATC CAATATGAGGTTATTAACAAAAGGGGCAACACCAAGATCATTGGTTCCCATCATGACTTC CAAGGATTATACTCCTGGGACGACGCTGAATGGGAAAACAGATTCAATCAAGCGTTAACT CTTGATGTGGATGTTGTAAAATTTGTGGGTACGGCTGTTAATTTCGAAGATAATTTGAGA CTGGAACACTTTAGGGATACACACAAGAATAAGCCTTTAATTGCAGTTAATATGACTTCT AAAGGTAGCATTTCTCGTGTTTTGAATAATGTTTTAACACCTGTGACATCAGATTTATTG CCTAACTCCGCTGCCCCTGGCCAATTGACAGTAGCACAAATTAACAAGATGTATACATCT ATGGGAGGTATCGAGCCTAAGGAACTGTTTGTTGTTGGAAAGCCAATTGGCCACTCTAGA TCGCCAATTTTACATAACACTGGCTATGAAATTTTAGGTTTACCTCACAAGTTCGATAAA TTTGAAACTGAATCCGCACAATTGGTGAAAGAAAAACTTTTGGACGGAAACAAGAACTTT GGCGGTGCTGCAGTCACAATTCCTCTGAAATTAGATATAATGCAGTACATGGATGAATTG ACTGATGCTGCTAAAGTTATTGGTGCTGTAAACACAGTTATACCATTGGGTAACAAGAAG TTTAAGGGTGATAATACCGACTGGTTAGGTATCCGTAATGCCTTAATTAACAATGGCGTT CCCGAATATGTTGGTCATACCGCTGGTTTGGTTATCGGTGCAGGTGGCACTTCTAGAGCC GCCCTTTACGCCTTGCACAGTTTAGGTTGCAAAAAGATCTTCATAATCAACAGGACAACT TCGAAATTGAAGCCATTAATAGAGTCACTTCCATCTGAATTCAACATTATTGGAATAGAG TCCACTAAATCTATAGAAGAGATTAAGGAACACGTTGGCGTTGCTGTCAGCTGTGTACCA GCCGACAAACCATTAGATGACGAACTTTTAAGTAAGCTGGAGAGATTCCTTGTGAAAGGT GCCCATGCTGCTTTTGTACCAACCTTATTGGAAGCCGCATACAAACCAAGCGTTACTCCC GTTATGACAATTTCACAAGACAAATATCAATGGCACGTTGTCCCTGGATCACAAATGTTA GTACACCAAGGTGTAGCTCAGTTTGAAAAGTGGACAGGATTCAAGGGCCCTTTCAAGGCC ATTTTTGATGCCGTTACGAAAGAGTAG
Protein Properties
Pfam Domain Function
Protein Residues1588
Protein Molecular Weight174754.0
Protein Theoretical pI6.22
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Pentafunctional AROM polypeptide MVQLAKVPILGNDIIHVGYNIHDHLVETIIKHCPSSTYVICNDTNLSKVPYYQQLVLEFK ASLPEGSRLLTYVVKPGETSKSRETKAQLEDYLLVEGCTRDTVMVAIGGGVIGDMIGFVA STFMRGVRVVQVPTSLLAMVDSSIGGKTAIDTPLGKNFIGAFWQPKFVLVDIKWLETLAK REFINGMAEVIKTACIWNADEFTRLESNASLFLNVVNGAKNVKVTNQLTNEIDEISNTDI EAMLDHTYKLVLESIKVKAEVVSSDERESSLRNLLNFGHSIGHAYEAILTPQALHGECVS IGMVKEAELSRYFGILSPTQVARLSKILVAYGLPVSPDEKWFKELTLHKKTPLDILLKKM SIDKKNEGSKKKVVILESIGKCYGDSAQFVSDEDLRFILTDETLVYPFKDIPADQQKVVI PPGSKSISNRALILAALGEGQCKIKNLLHSDDTKHMLTAVHELKGATISWEDNGETVVVE GHGGSTLSACADPLYLGNAGTASRFLTSLAALVNSTSSQKYIVLTGNARMQQRPIAPLVD SLRANGTKIEYLNNEGSLPIKVYTDSVFKGGRIELAATVSSQYVSSILMCAPYAEEPVTL ALVGGKPISKLYVDMTIKMMEKFGINVETSTTEPYTYYIPKGHYINPSEYVIESDASSAT YPLAFAAMTGTTVTVPNIGFESLQGDARFARDVLKPMGCKITQTATSTTVSGPPVGTLKP LKHVDMEPMTDAFLTACVVAAISHDSDPNSANTTTIEGIANQRVKECNRILAMATELAKF GVKTTELPDGIQVHGLNSIKDLKVPSDSSGPVGVCTYDDHRVAMSFSLLAGMVNSQNERD EVANPVRILERHCTGKTWPGWWDVLHSELGAKLDGAEPLECTSKKNSKKSVVIIGMRAAG KTTISKWCASALGYKLVDLDELFEQQHNNQSVKQFVVENGWEKFREEETRIFKEVIQNYG DDGYVFSTGGGIVESAESRKALKDFASSGGYVLHLHRDIEETIVFLQSDPSRPAYVEEIR EVWNRREGWYKECSNFSFFAPHCSAEAEFQALRRSFSKYIATITGVREIEIPSGRSAFVC LTFDDLTEQTENLTPICYGCEAVEVRVDHLANYSADFVSKQLSILRKATDSIPIIFTVRT MKQGGNFPDEEFKTLRELYDIALKNGVEFLDLELTLPTDIQYEVINKRGNTKIIGSHHDF QGLYSWDDAEWENRFNQALTLDVDVVKFVGTAVNFEDNLRLEHFRDTHKNKPLIAVNMTS KGSISRVLNNVLTPVTSDLLPNSAAPGQLTVAQINKMYTSMGGIEPKELFVVGKPIGHSR SPILHNTGYEILGLPHKFDKFETESAQLVKEKLLDGNKNFGGAAVTIPLKLDIMQYMDEL TDAAKVIGAVNTVIPLGNKKFKGDNTDWLGIRNALINNGVPEYVGHTAGLVIGAGGTSRA ALYALHSLGCKKIFIINRTTSKLKPLIESLPSEFNIIGIESTKSIEEIKEHVGVAVSCVP ADKPLDDELLSKLERFLVKGAHAAFVPTLLEAAYKPSVTPVMTISQDKYQWHVVPGSQML VHQGVAQFEKWTGFKGPFKAIFDAVTKE
References
External Links
ResourceLink
Saccharomyces Genome Database ARO1
Uniprot IDP08566
Uniprot NameARO1_YEAST
GenBank Gene IDX06077
Genebank Protein ID3381
General Reference
  • Duncan, K., Edwards, R. M., Coggins, J. R. (1987). "The pentafunctional arom enzyme of Saccharomyces cerevisiae is a mosaic of monofunctional domains." Biochem J 246:375-386.2825635
  • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867
  • Duncan, K., Edwards, R. M., Coggins, J. R. (1988). "The Saccharomyces cerevisiae ARO1 gene. An example of the co-ordinate regulation of five enzymes on a single biosynthetic pathway." FEBS Lett 241:83-88.2848727
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106