You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameOrnithine decarboxylase
Synonyms
  • ODC
Gene NameSPE1
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionL-ornithine = putrescine + CO(2)
Cellular LocationNot Available
SMPDB Pathways
Glutathione metabolismPW002395 ThumbThumb?image type=greyscaleThumb?image type=simple
beta-Alanine metabolismPW002381 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Arginine and proline metabolismec00330 Map00330
Glutathione metabolismec00480 Map00480
beta-Alanine metabolismec00410 Map00410
SMPDB Reactions
Ornithine + hydronCarbon dioxide + Putrescine
KEGG Reactions
Ornithine + hydronPutrescine + Carbon dioxide
Metabolites
YMDB IDNameView
YMDB00132PutrescineShow
YMDB00353OrnithineShow
YMDB00862hydronShow
YMDB00912Carbon dioxideShow
GO Classification
Component
Not Available
Function
catalytic activity
Process
polyamine biosynthetic process
metabolic process
cellular amino acid derivative metabolic process
cellular biogenic amine metabolic process
cellular metabolic process
cellular amino acid and derivative metabolic process
polyamine metabolic process
Gene Properties
Chromosome Locationchromosome 11
LocusYKL184W
Gene Sequence>1401 bp ATGTCTAGTACTCAAGTAGGAAATGCTCTATCTAGTTCCACTACTACTTTAGTGGACTTG TCTAATTCTACGGTTACCCAAAAGAAGCAATATTATAAAGATGGCGAGACGCTGCACAAT CTTTTGCTTGAACTAAAGAATAACCAAGATTTGGAACTTTTACCGCATGAACAAGCGCAT CCTAAAATATTTCAAGCGCTCAAGGCTCGTATTGGTAGAATTAATAATGAAACGTGCGAC CCCGGTGAGGAGAACTCGTTTTTCATATGCGATTTGGGAGAAGTCAAGAGATTATTCAAC AACTGGGTGAAGGAGCTTCCTAGAATTAAGCCATTTTATGCCGTCAAATGTAATCCTGAT ACCAAGGTTTTGTCATTATTAGCAGAGTTGGGCGTTAATTTCGATTGCGCTTCCAAAGTG GAAATTGACAGAGTATTATCGATGAACATCTCGCCGGATAGAATTGTTTACGCTAATCCT TGTAAAGTAGCATCTTTCATTAGATATGCAGCTTCAAAAAATGTAATGAAGTCTACTTTT GACAATGTAGAAGAATTGCATAAAATCAAAAAGTTTCATCCTGAGTCTCAGTTGTTATTA AGAATCGCTACCGATGACTCTACCGCTCAATGTCGACTTTCCACCAAATATGGCTGTGAA ATGGAAAACGTAGACGTTTTATTAAAGGCTATAAAGGAACTAGGTTTAAACCTGGCTGGT GTTTCTTTCCACGTCGGTTCAGGCGCTTCTGATTTTACAAGCTTATACAAAGCCGTTAGA GATGCAAGAACGGTATTTGACAAAGCTGCTAACGAATACGGGTTGCCCCCTTTGAAGATT TTGGATGTAGGTGGTGGATTTCAATTTGAATCCTTCAAAGAATCAACTGCTGTTTTGCGT CTAGCGCTAGAGGAATTTTTCCCTGTAGGTTGTGGTGTTGATATAATTGCAGAGCCTGGC AGATACTTTGTAGCTACAGCGTTCACTTTGGCATCTCATGTGATTGCGAAGAGAAAACTG TCTGAGAATGAAGCAATGATTTACACTAACGATGGTGTATACGGGAACATGAATTGTATT TTATTCGATCATCAAGAGCCCCATCCAAGAACCCTTTATCATAATTTGGAATTTCATTAC GACGATTTTGAATCCACTACTGCGGTCCTCGACTCTATCAACAAAACAAGATCTGAGTAT CCATATAAAGTTTCCATCTGGGGACCCACATGTGATGGTTTGGATTGTATTGCCAAAGAG TATTACATGAAGCATGATGTTATAGTCGGTGATTGGTTTTATTTTCCTGCCCTGGGTGCC TACACATCATCGGCGGCTACTCAATTCAACGGCTTTGAGCAGACTGCGGATATAGTATAC ATAGACTCTGAACTCGATTGA
Protein Properties
Pfam Domain Function
Protein Residues466
Protein Molecular Weight52284.80078
Protein Theoretical pI5.22
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Ornithine decarboxylase MSSTQVGNALSSSTTTLVDLSNSTVTQKKQYYKDGETLHNLLLELKNNQDLELLPHEQAH PKIFQALKARIGRINNETCDPGEENSFFICDLGEVKRLFNNWVKELPRIKPFYAVKCNPD TKVLSLLAELGVNFDCASKVEIDRVLSMNISPDRIVYANPCKVASFIRYAASKNVMKSTF DNVEELHKIKKFHPESQLLLRIATDDSTAQCRLSTKYGCEMENVDVLLKAIKELGLNLAG VSFHVGSGASDFTSLYKAVRDARTVFDKAANEYGLPPLKILDVGGGFQFESFKESTAVLR LALEEFFPVGCGVDIIAEPGRYFVATAFTLASHVIAKRKLSENEAMIYTNDGVYGNMNCI LFDHQEPHPRTLYHNLEFHYDDFESTTAVLDSINKTRSEYPYKVSIWGPTCDGLDCIAKE YYMKHDVIVGDWFYFPALGAYTSSAATQFNGFEQTADIVYIDSELD
References
External Links
ResourceLink
Saccharomyces Genome Database SPE1
Uniprot IDP08432
Uniprot NameDCOR_YEAST
GenBank Gene IDJ02777
Genebank Protein ID172070
General Reference
  • Fonzi, W. A., Sypherd, P. S. (1987). "The gene and the primary structure of ornithine decarboxylase from Saccharomyces cerevisiae." J Biol Chem 262:10127-10133.3038869
  • Wiemann, S., Voss, H., Schwager, C., Rupp, T., Stegemann, J., Zimmermann, J., Grothues, D., Sensen, C., Erfle, H., Hewitt, N., et, a. l. .. (1993). "Sequencing and analysis of 51.6 kilobases on the left arm of chromosome XI from Saccharomyces cerevisiae reveals 23 open reading frames including the FAS1 gene." Yeast 9:1343-1348.8154185
  • Dujon, B., Alexandraki, D., Andre, B., Ansorge, W., Baladron, V., Ballesta, J. P., Banrevi, A., Bolle, P. A., Bolotin-Fukuhara, M., Bossier, P., et, a. l. .. (1994). "Complete DNA sequence of yeast chromosome XI." Nature 369:371-378.8196765
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106