You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameGalactose-1-phosphate uridylyltransferase
Synonyms
  • Gal-1-P uridylyltransferase
  • UDP-glucose--hexose-1-phosphate uridylyltransferase
Gene NameGAL7
Enzyme Class
Biological Properties
General FunctionInvolved in UDP-glucose:hexose-1-phosphate uridylyltransferase activity
Specific FunctionUDP-glucose + alpha-D-galactose 1-phosphate = alpha-D-glucose 1-phosphate + UDP-galactose
Cellular LocationNot Available
SMPDB Pathways
Amino sugar and nucleotide sugar metabolismPW002413 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Amino sugar and nucleotide sugar metabolismec00520 Map00520
Galactose metabolismec00052 Map00052
SMPDB Reactions
Galactose 1-phosphate + Uridine diphosphate glucoseGlucose 1-phosphate + UDP-D-galactose
UDP-D-galactose + Glucose 1-phosphateUridine diphosphate glucose + Galactose 1-phosphate
KEGG Reactions
Uridine triphosphate + Galactose 1-phosphate + hydronPyrophosphate + UDP-D-galactose
Galactose 1-phosphate + Uridine diphosphate glucoseUDP-D-galactose + Glucose 1-phosphate
Metabolites
YMDB IDNameView
YMDB00004Galactose 1-phosphateShow
YMDB00212Uridine diphosphate glucoseShow
YMDB00219PyrophosphateShow
YMDB00288Glucose 1-phosphateShow
YMDB00326Uridine triphosphateShow
YMDB00415UDP-D-glucoseShow
YMDB00692UDP-D-galactoseShow
YMDB00797udp-galactoseShow
YMDB00862hydronShow
YMDB00970alpha-D-glucose 1-phosphateShow
GO Classification
Component
Not Available
Function
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
zinc ion binding
binding
nucleotidyltransferase activity
ion binding
uridylyltransferase activity
cation binding
UDP-glucose:hexose-1-phosphate uridylyltransferase activity
metal ion binding
transition metal ion binding
Process
alcohol metabolic process
monosaccharide metabolic process
metabolic process
hexose metabolic process
galactose metabolic process
small molecule metabolic process
Gene Properties
Chromosome Locationchromosome 2
LocusYBR018C
Gene Sequence>1101 bp ATGACTGCTGAAGAATTTGATTTTTCTAGCCATTCCCATAGACGTTACAATCCACTAACC GATTCATGGATCTTAGTTTCTCCACACAGAGCTAAAAGACCTTGGTTAGGTCAACAGGAG GCTGCTTACAAGCCCACAGCTCCATTGTATGATCCAAAATGCTATCTATGTCCTGGTAAC AAAAGAGCTACTGGTAACCTAAACCCAAGATATGAATCAACGTATATTTTCCCCAATGAT TATGCTGCCGTTAGGCTCGATCAACCTATTTTACCACAGAATGATTCCAATGAGGATAAT CTTAAAAATAGGCTGCTTAAAGTGCAATCTGTGAGAGGCAATTGTTTCGTCATATGTTTT AGCCCCAATCATAATCTAACCATTCCACAAATGAAACAATCAGATCTGGTTCATATTGTT AATTCTTGGCAAGCATTGACTGACGATCTCTCCAGAGAAGCAAGAGAAAATCATAAGCCT TTCAAATATGTCCAAATATTTGAAAACAAAGGTACAGCCATGGGTTGTTCCAACTTACAT CCACATGGCCAAGCTTGGTGCTTAGAATCCATCCCTAGTGAAGTTTCGCAAGAATTGAAA TCTTTTGATAAATATAAACGTGAACACAATACTGATTTGTTTGCCGATTACGTCAAATTA GAATCAAGAGAGAAGTCAAGAGTCGTAGTGGAGAATGAATCCTTTATTGTTGTTGTTCCA TACTGGGCCATCTGGCCATTTGAGACCTTGGTCATTTCAAAGAAGAAGCTTGCCTCAATT AGCCAATTTAACCAAATGGTGAAGGAGGACCTCGCCTCGATTTTAAAGCAACTAACTATT AAGTATGATAATTTATTTGAAACGAGTTTCCCATACTCAATGGGTATCCATCAGGCTCCT TTGAATGCGACTGGTGATGAATTGAGTAATAGTTGGTTTCACATGCATTTCTACCCACCT TTACTGAGATCAGCTACTGTTCGGAAATTCTTGGTTGGTTTTGAATTGTTAGGTGAGCCT CAAAGAGATTTAACTTCGGAACAAGCTGCTGAAAAACTAAGAAATTTAGATGGTCAGATT CATTATCTACAAAGACTGTAA
Protein Properties
Pfam Domain Function
Protein Residues366
Protein Molecular Weight42384.69922
Protein Theoretical pI7.64
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Galactose-1-phosphate uridylyltransferase MTAEEFDFSSHSHRRYNPLTDSWILVSPHRAKRPWLGQQEAAYKPTAPLYDPKCYLCPGN KRATGNLNPRYESTYIFPNDYAAVRLDQPILPQNDSNEDNLKNRLLKVQSVRGNCFVICF SPNHNLTIPQMKQSDLVHIVNSWQALTDDLSREARENHKPFKYVQIFENKGTAMGCSNLH PHGQAWCLESIPSEVSQELKSFDKYKREHNTDLFADYVKLESREKSRVVVENESFIVVVP YWAIWPFETLVISKKKLASISQFNQMVKEDLASILKQLTIKYDNLFETSFPYSMGIHQAP LNATGDELSNSWFHMHFYPPLLRSATVRKFLVGFELLGEPQRDLTSEQAAEKLRNLDGQI HYLQRL
References
External Links
ResourceLink
Saccharomyces Genome Database GAL7
Uniprot IDP08431
Uniprot NameGAL7_YEAST
GenBank Gene IDX81324
Genebank Protein ID587574
General Reference
  • Tajima, M., Nogi, Y., Fukasawa, T. (1985). "Primary structure of the Saccharomyces cerevisiae GAL7 gene." Yeast 1:67-77.2851900
  • Schaaff-Gerstenschlager, I., Schindwolf, T., Lehnert, W., Rose, M., Zimmermann, F. K. (1995). "Sequence and functional analysis of a 7.2 kb fragment of Saccharomyces cerevisiae chromosome II including GAL7 and GAL10 and a new essential open reading frame." Yeast 11:79-83.7762304
  • Feldmann, H., Aigle, M., Aljinovic, G., Andre, B., Baclet, M. C., Barthe, C., Baur, A., Becam, A. M., Biteau, N., Boles, E., Brandt, T., Brendel, M., Bruckner, M., Bussereau, F., Christiansen, C., Contreras, R., Crouzet, M., Cziepluch, C., Demolis, N., Delaveau, T., Doignon, F., Domdey, H., Dusterhus, S., Dubois, E., Dujon, B., El Bakkoury, M., Entian, K. D., Feurmann, M., Fiers, W., Fobo, G. M., Fritz, C., Gassenhuber, H., Glandsdorff, N., Goffeau, A., Grivell, L. A., de Haan, M., Hein, C., Herbert, C. J., Hollenberg, C. P., Holmstrom, K., Jacq, C., Jacquet, M., Jauniaux, J. C., Jonniaux, J. L., Kallesoe, T., Kiesau, P., Kirchrath, L., Kotter, P., Korol, S., Liebl, S., Logghe, M., Lohan, A. J., Louis, E. J., Li, Z. Y., Maat, M. J., Mallet, L., Mannhaupt, G., Messenguy, F., Miosga, T., Molemans, F., Muller, S., Nasr, F., Obermaier, B., Perea, J., Pierard, A., Piravandi, E., Pohl, F. M., Pohl, T. M., Potier, S., Proft, M., Purnelle, B., Ramezani Rad, M., Rieger, M., Rose, M., Schaaff-Gerstenschlager, I., Scherens, B., Schwarzlose, C., Skala, J., Slonimski, P. P., Smits, P. H., Souciet, J. L., Steensma, H. Y., Stucka, R., Urrestarazu, A., van der Aart, Q. J., van Dyck, L., Vassarotti, A., Vetter, I., Vierendeels, F., Vissers, S., Wagner, G., de Wergifosse, P., Wolfe, K. H., Zagulski, M., Zimmermann, F. K., Mewes, H. W., Kleine, K. (1994). "Complete DNA sequence of yeast chromosome II." EMBO J 13:5795-5809.7813418
  • Citron, B. A., Donelson, J. E. (1984). "Sequence of the Saccharomyces GAL region and its transcription in vivo." J Bacteriol 158:269-278.6715281
  • Nogi, Y., Fukasawa, T. (1983). "Nucleotide sequence of the transcriptional initiation region of the yeast GAL7 gene." Nucleic Acids Res 11:8555-8568.6324089