You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameFumarate hydratase, mitochondrial
Synonyms
  • Fumarase
Gene NameFUM1
Enzyme Class
Biological Properties
General FunctionInvolved in fumarate hydratase activity
Specific Function(S)-malate = fumarate + H(2)O
Cellular LocationMitochondrion matrix. Cytoplasm.
SMPDB Pathways
Citric Acid Cycle 1434561204PW000970 ThumbThumb?image type=greyscaleThumb?image type=simple
TCA CyclePW002377 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Citrate cycle (TCA cycle)ec00020 Map00020
SMPDB Reactions
(S)-Malic acidFumaric acid + water
L-Aspartic acidFumaric acid + Ammonia
KEGG Reactions
Fumaric acid + water(S)-malate(2-)
Metabolites
YMDB IDNameView
YMDB00091AmmoniaShow
YMDB00101Fumaric acidShow
YMDB00280(S)-Malic acidShow
YMDB00890waterShow
YMDB00896L-Aspartic acidShow
GO Classification
Component
tricarboxylic acid cycle enzyme complex
macromolecular complex
protein complex
Function
hydro-lyase activity
catalytic activity
lyase activity
carbon-oxygen lyase activity
fumarate hydratase activity
Process
fumarate metabolic process
acetyl-CoA metabolic process
acetyl-CoA catabolic process
tricarboxylic acid cycle
organic acid metabolic process
metabolic process
oxoacid metabolic process
carboxylic acid metabolic process
cellular metabolic process
cofactor metabolic process
coenzyme metabolic process
dicarboxylic acid metabolic process
Gene Properties
Chromosome Locationchromosome 16
LocusYPL262W
Gene Sequence>1467 bp ATGTTGAGATTTACCAATTGTAGTTGCAAGACTTTCGTAAAATCGTCATATAAGCTTAAT ATAAGAAGAATGAACTCCTCGTTCAGAACTGAAACCGATGCATTTGGTGAGATACACGTG CCTGCTGATAAGTACTGGGGTGCCCAAACTCAAAGATCCTTTCAAAACTTCAAGATTGGT GGCGCTCGTGAAAGAATGCCATTGCCTTTGGTGCATGCATTTGGTGTTTTGAAGAAATCT GCCGCGATTGTGAATGAGTCTCTGGGGGGATTGGATCCCAAGATCTCCAAGGCTATTCAA CAGGCCGCTGACGAAGTGGCTTCTGGTAAGCTAGACGACCACTTTCCATTGGTTGTTTTC CAAACGGGTTCCGGTACCCAGTCTAACATGAACGCTAATGAAGTTATTTCCAATCGTGCC ATTGAGATCCTAGGAGGCAAGATTGGATCTAAACAAGTCCATCCAAACAATCATTGCAAC CAATCTCAATCATCCAATGATACTTTCCCCACTGTCGTGCATATCGCTGCCAGTTTGCAA ATTCAAAACGAGTTGATACCTGAGTTGACCAATTTAAAGAACGCCCTTGAAGCCAAATCC AAGGAATTTGACCATATTGTGAAGATCGGTAGAACACACTTGCAAGATGCCACGCCTTTG ACACTAGGTCAAGAGTTTTCCGGTTACGTGCAACAAGTTGAGAACGGTATCCAAAGAGTG GCACATTCTTTGAAAACATTGAGTTTCCTGGCACAAGGTGGTACTGCCGTTGGTACAGGG TTGAACACCAAGCCCGGATTCGATGTCAAGATAGCCGAGCAAATTTCCAAAGAAACTGGA CTAAAGTTTCAAACCGCCCCTAATAGGTTCGAGGCTTTGGCTGCTCACGACGCCATTGTC GAATGTAGCGGTGCTCTAAACACCCTTGCTTGTTCTCTTTTCAAAATAGCGCAAGATATA AGATACTTAGGGTCCGGGCCACGTTGCGGCTACCATGAACTAATGCTGCCAGAGAATGAA CCAGGTTCCTCAATCATGCCTGGTAAAGTTAACCCAACCCAAAACGAGGCATTGACTCAA GTGTGTGTGCAAGTCATGGGTAACAATGCAGCTATCACGTTTGCCGGCTCTCAAGGTCAA TTCGAGTTAAATGTCTTCAAGCCAGTCATGATCGTCAATCTATTGAATTCGATCAGGTTA ATTACTGATGCCGCATATTCATTTAGAGTGCACTGTGTTGAAGGTATCAAAGCCAATGAG CCTCGTATTCATGAGTTGTTGACTAAATCTTTAATGTTAGTCACCGCTTTGAACCCTAAG ATCGGTTATGATGCCGCTTCCAAGGTCGCCAAGAATGCTCATAAGAAGGGCATTACCTTG AAGGAAAGTGCATTGGAATTGGGTGTATTGACTGAAAAGGAATTTGATGAATGGGTTGTT CCTGAACACATGCTAGGTCCTAAATAA
Protein Properties
Pfam Domain Function
Protein Residues488
Protein Molecular Weight53151.5
Protein Theoretical pI8.4
PDB Fileshow
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Fumarate hydratase, mitochondrial MLRFTNCSCKTFVKSSYKLNIRRMNSSFRTETDAFGEIHVPADKYWGAQTQRSFQNFKIG GARERMPLPLVHAFGVLKKSAAIVNESLGGLDPKISKAIQQAADEVASGKLDDHFPLVVF QTGSGTQSNMNANEVISNRAIEILGGKIGSKQVHPNNHCNQSQSSNDTFPTVMHIAASLQ IQNELIPELTNLKNALEAKSKEFDHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRV AHSLKTLSFLAQGGTAVGTGLNTKPGFDVKIAEQISKETGLKFQTAPNKFEALAAHDAIV ECSGALNTLACSLFKIAQDIRYLGSGPRCGYHELMLPENEPGSSIMPGKVNPTQNEALTQ VCVQVMGNNAAITFAGSQGQFELNVFKPVMIANLLNSIRLITDAAYSFRVHCVEGIKANE PRIHELLTKSLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLTEKEFDEWVV PEHMLGPK
References
External Links
ResourceLink
Saccharomyces Genome Database FUM1
Uniprot IDP08417
Uniprot NameFUMH_YEAST
GenBank Gene IDJ02802
Genebank Protein ID171523
PDB ID
1YFM
General Reference
  • Wu, M., Tzagoloff, A. (1987). "Mitochondrial and cytoplasmic fumarases in Saccharomyces cerevisiae are encoded by a single nuclear gene FUM1." J Biol Chem 262:12275-12282.3040736
  • Bussey, H., Storms, R. K., Ahmed, A., Albermann, K., Allen, E., Ansorge, W., Araujo, R., Aparicio, A., Barrell, B., Badcock, K., Benes, V., Botstein, D., Bowman, S., Bruckner, M., Carpenter, J., Cherry, J. M., Chung, E., Churcher, C., Coster, F., Davis, K., Davis, R. W., Dietrich, F. S., Delius, H., DiPaolo, T., Hani, J., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XVI." Nature 387:103-105.9169875
  • Grandier-Vazeille, X., Bathany, K., Chaignepain, S., Camougrand, N., Manon, S., Schmitter, J. M. (2001). "Yeast mitochondrial dehydrogenases are associated in a supramolecular complex." Biochemistry 40:9758-9769.11502169
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Reinders, J., Wagner, K., Zahedi, R. P., Stojanovski, D., Eyrich, B., van der Laan, M., Rehling, P., Sickmann, A., Pfanner, N., Meisinger, C. (2007). "Profiling phosphoproteins of yeast mitochondria reveals a role of phosphorylation in assembly of the ATP synthase." Mol Cell Proteomics 6:1896-1906.17761666
  • Weaver, T., Lees, M., Zaitsev, V., Zaitseva, I., Duke, E., Lindley, P., McSweeny, S., Svensson, A., Keruchenko, J., Keruchenko, I., Gladilin, K., Banaszak, L. (1998). "Crystal structures of native and recombinant yeast fumarase." J Mol Biol 280:431-442.9665847