You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameFumarate hydratase, mitochondrial
Synonyms
  • Fumarase
Gene NameFUM1
Enzyme Class
Biological Properties
General FunctionInvolved in fumarate hydratase activity
Specific Function(S)-malate = fumarate + H(2)O
Cellular LocationMitochondrion matrix. Cytoplasm.
SMPDB Pathways
Citric Acid Cycle 1434561204PW000970 ThumbThumb?image type=greyscaleThumb?image type=simple
TCA CyclePW002377 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Citrate cycle (TCA cycle)ec00020 Map00020
SMPDB Reactions
(S)-Malic acidFumaric acid + water
L-Aspartic acidFumaric acid + Ammonia
KEGG Reactions
Fumaric acid + water(S)-malate(2-)
Metabolites
YMDB IDNameView
YMDB00091AmmoniaShow
YMDB00101Fumaric acidShow
YMDB00280(S)-Malic acidShow
YMDB00890waterShow
YMDB00896L-Aspartic acidShow
GO Classification
Component
macromolecular complex
protein complex
tricarboxylic acid cycle enzyme complex
Function
carbon-oxygen lyase activity
fumarate hydratase activity
hydro-lyase activity
catalytic activity
lyase activity
Process
cofactor metabolic process
coenzyme metabolic process
dicarboxylic acid metabolic process
fumarate metabolic process
acetyl-CoA metabolic process
acetyl-CoA catabolic process
tricarboxylic acid cycle
organic acid metabolic process
metabolic process
oxoacid metabolic process
carboxylic acid metabolic process
cellular metabolic process
Gene Properties
Chromosome Locationchromosome 16
LocusYPL262W
Gene Sequence>1467 bp ATGTTGAGATTTACCAATTGTAGTTGCAAGACTTTCGTAAAATCGTCATATAAGCTTAAT ATAAGAAGAATGAACTCCTCGTTCAGAACTGAAACCGATGCATTTGGTGAGATACACGTG CCTGCTGATAAGTACTGGGGTGCCCAAACTCAAAGATCCTTTCAAAACTTCAAGATTGGT GGCGCTCGTGAAAGAATGCCATTGCCTTTGGTGCATGCATTTGGTGTTTTGAAGAAATCT GCCGCGATTGTGAATGAGTCTCTGGGGGGATTGGATCCCAAGATCTCCAAGGCTATTCAA CAGGCCGCTGACGAAGTGGCTTCTGGTAAGCTAGACGACCACTTTCCATTGGTTGTTTTC CAAACGGGTTCCGGTACCCAGTCTAACATGAACGCTAATGAAGTTATTTCCAATCGTGCC ATTGAGATCCTAGGAGGCAAGATTGGATCTAAACAAGTCCATCCAAACAATCATTGCAAC CAATCTCAATCATCCAATGATACTTTCCCCACTGTCGTGCATATCGCTGCCAGTTTGCAA ATTCAAAACGAGTTGATACCTGAGTTGACCAATTTAAAGAACGCCCTTGAAGCCAAATCC AAGGAATTTGACCATATTGTGAAGATCGGTAGAACACACTTGCAAGATGCCACGCCTTTG ACACTAGGTCAAGAGTTTTCCGGTTACGTGCAACAAGTTGAGAACGGTATCCAAAGAGTG GCACATTCTTTGAAAACATTGAGTTTCCTGGCACAAGGTGGTACTGCCGTTGGTACAGGG TTGAACACCAAGCCCGGATTCGATGTCAAGATAGCCGAGCAAATTTCCAAAGAAACTGGA CTAAAGTTTCAAACCGCCCCTAATAGGTTCGAGGCTTTGGCTGCTCACGACGCCATTGTC GAATGTAGCGGTGCTCTAAACACCCTTGCTTGTTCTCTTTTCAAAATAGCGCAAGATATA AGATACTTAGGGTCCGGGCCACGTTGCGGCTACCATGAACTAATGCTGCCAGAGAATGAA CCAGGTTCCTCAATCATGCCTGGTAAAGTTAACCCAACCCAAAACGAGGCATTGACTCAA GTGTGTGTGCAAGTCATGGGTAACAATGCAGCTATCACGTTTGCCGGCTCTCAAGGTCAA TTCGAGTTAAATGTCTTCAAGCCAGTCATGATCGTCAATCTATTGAATTCGATCAGGTTA ATTACTGATGCCGCATATTCATTTAGAGTGCACTGTGTTGAAGGTATCAAAGCCAATGAG CCTCGTATTCATGAGTTGTTGACTAAATCTTTAATGTTAGTCACCGCTTTGAACCCTAAG ATCGGTTATGATGCCGCTTCCAAGGTCGCCAAGAATGCTCATAAGAAGGGCATTACCTTG AAGGAAAGTGCATTGGAATTGGGTGTATTGACTGAAAAGGAATTTGATGAATGGGTTGTT CCTGAACACATGCTAGGTCCTAAATAA
Protein Properties
Pfam Domain Function
Protein Residues488
Protein Molecular Weight53151.5
Protein Theoretical pI8.4
PDB Fileshow
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Fumarate hydratase, mitochondrial MLRFTNCSCKTFVKSSYKLNIRRMNSSFRTETDAFGEIHVPADKYWGAQTQRSFQNFKIG GARERMPLPLVHAFGVLKKSAAIVNESLGGLDPKISKAIQQAADEVASGKLDDHFPLVVF QTGSGTQSNMNANEVISNRAIEILGGKIGSKQVHPNNHCNQSQSSNDTFPTVMHIAASLQ IQNELIPELTNLKNALEAKSKEFDHIVKIGRTHLQDATPLTLGQEFSGYVQQVENGIQRV AHSLKTLSFLAQGGTAVGTGLNTKPGFDVKIAEQISKETGLKFQTAPNKFEALAAHDAIV ECSGALNTLACSLFKIAQDIRYLGSGPRCGYHELMLPENEPGSSIMPGKVNPTQNEALTQ VCVQVMGNNAAITFAGSQGQFELNVFKPVMIANLLNSIRLITDAAYSFRVHCVEGIKANE PRIHELLTKSLMLVTALNPKIGYDAASKVAKNAHKKGITLKESALELGVLTEKEFDEWVV PEHMLGPK
References
External Links
ResourceLink
Saccharomyces Genome Database FUM1
Uniprot IDP08417
Uniprot NameFUMH_YEAST
GenBank Gene IDJ02802
Genebank Protein ID171523
PDB ID
1YFM
General Reference
  • Wu, M., Tzagoloff, A. (1987). "Mitochondrial and cytoplasmic fumarases in Saccharomyces cerevisiae are encoded by a single nuclear gene FUM1." J Biol Chem 262:12275-12282.3040736
  • Bussey, H., Storms, R. K., Ahmed, A., Albermann, K., Allen, E., Ansorge, W., Araujo, R., Aparicio, A., Barrell, B., Badcock, K., Benes, V., Botstein, D., Bowman, S., Bruckner, M., Carpenter, J., Cherry, J. M., Chung, E., Churcher, C., Coster, F., Davis, K., Davis, R. W., Dietrich, F. S., Delius, H., DiPaolo, T., Hani, J., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XVI." Nature 387:103-105.9169875
  • Grandier-Vazeille, X., Bathany, K., Chaignepain, S., Camougrand, N., Manon, S., Schmitter, J. M. (2001). "Yeast mitochondrial dehydrogenases are associated in a supramolecular complex." Biochemistry 40:9758-9769.11502169
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Reinders, J., Wagner, K., Zahedi, R. P., Stojanovski, D., Eyrich, B., van der Laan, M., Rehling, P., Sickmann, A., Pfanner, N., Meisinger, C. (2007). "Profiling phosphoproteins of yeast mitochondria reveals a role of phosphorylation in assembly of the ATP synthase." Mol Cell Proteomics 6:1896-1906.17761666
  • Weaver, T., Lees, M., Zaitsev, V., Zaitseva, I., Duke, E., Lindley, P., McSweeny, S., Svensson, A., Keruchenko, J., Keruchenko, I., Gladilin, K., Banaszak, L. (1998). "Crystal structures of native and recombinant yeast fumarase." J Mol Biol 280:431-442.9665847