You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameCytochrome b-c1 complex subunit Rieske, mitochondrial
Synonyms
  • Complex III subunit 5
  • Rieske iron-sulfur protein
  • RISP
  • Ubiquinol-cytochrome c reductase iron-sulfur subunit
Gene NameRIP1
Enzyme Class
Biological Properties
General FunctionInvolved in oxidoreductase activity
Specific FunctionComponent of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain that generates an electrochemical potential coupled to ATP synthesis. The complex couples electron transfer from ubiquinol to cytochrome c
Cellular LocationMitochondrion
SMPDB Pathways
Oxidative phosphorylationPW002461 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Oxidative phosphorylationec00190 Map00190
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00088Ubiquinone Q1Show
YMDB00862hydronShow
YMDB00902ubiquinolShow
GO Classification
Component
cell part
membrane
Function
substrate-specific transmembrane transporter activity
ion transmembrane transporter activity
cation transmembrane transporter activity
inorganic cation transmembrane transporter activity
monovalent inorganic cation transmembrane transporter activity
hydrogen ion transmembrane transporter activity
catalytic activity
2 iron, 2 sulfur cluster binding
ubiquinol-cytochrome-c reductase activity
oxidoreductase activity, acting on diphenols and related substances as donors
binding
metal cluster binding
iron-sulfur cluster binding
oxidoreductase activity
transporter activity
transmembrane transporter activity
Process
metabolic process
oxidation reduction
Gene Properties
Chromosome Locationchromosome 5
LocusYEL024W
Gene Sequence>648 bp ATGTTAGGAATAAGATCATCTGTCAAGACCTGCTTCAAGCCAATGTCTTTAACTTCCAAA AGACTGATTTCTCAATCTTTGCTGGCTAGCAAATCCACGTACAGGACCCCAAATTTTGAT GACGTTTTAAAGGAAAATAACGATGCTGATAAAGGCCGTTCTTATGCTTACTTTATGGTC GGTGCTATGGGTCTTTTGTCATCTGCAGGTGCCAAATCAACCGTAGAAACCTTTATTTCA TCTATGACCGCTACTGCCGATGTTTTGGCTATGGCTAAAGTTGAAGTTAATTTAGCGGCT ATCCCATTGGGTAAAAACGTGGTTGTCAAATGGCAAGGTAAGCCTGTGTTCATTAGACAC AGAACTCCTCATGAAATTCAGGAAGCCAACAGTGTGGATATGTCCGCTTTGAAGGACCCA CAGACCGATGCTGACAGAGTCAAAGACCCTCAATGGTTAATTATGCTGGGTATTTGTACT CACTTAGGTTGTGTTCCAATTGGTGAAGCCGGTGATTTTGGTGGTTGGTTCTGTCCTTGC CATGGTTCACATTATGATATTTCCGGTAGAATCAGAAAGGGACCTGCCCCCTTAAACTTA GAAATTCCTGCTTATGAATTCGATGGTGATAAGGTCATTGTTGGTTAG
Protein Properties
Pfam Domain Function
Protein Residues215
Protein Molecular Weight23364.69922
Protein Theoretical pI8.21
PDB Fileshow
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Cytochrome b-c1 complex subunit Rieske, mitochondrial MLGIRSSVKTCFKPMSLTSKRLISQSLLASKSTYRTPNFDDVLKENNDADKGRSYAYFMV GAMGLLSSAGAKSTVETFISSMTATADVLAMAKVEVNLAAIPLGKNVVVKWQGKPVFIRH RTPHEIQEANSVDMSALKDPQTDADRVKDPQWLIMLGICTHLGCVPIGEAGDFGGWFCPC HGSHYDISGRIRKGPAPLNLEIPAYEFDGDKVIVG
References
External Links
ResourceLink
Saccharomyces Genome Database RIP1
Uniprot IDP08067
Uniprot NameUCRI_YEAST
GenBank Gene IDAY558341
Genebank Protein ID45270572
PDB ID
1P84
General Reference
  • Beckmann, J. D., Ljungdahl, P. O., Lopez, J. L., Trumpower, B. L. (1987). "Isolation and characterization of the nuclear gene encoding the Rieske iron-sulfur protein (RIP1) from Saccharomyces cerevisiae." J Biol Chem 262:8901-8909.3036836
  • Beckmann, J. D., Ljungdahl, P. O., Trumpower, B. L. (1989). "Mutational analysis of the mitochondrial Rieske iron-sulfur protein of Saccharomyces cerevisiae. I. Construction of a RIP1 deletion strain and isolation of temperature-sensitive mutants." J Biol Chem 264:3713-3722.2645276
  • Dietrich, F. S., Mulligan, J., Hennessy, K., Yelton, M. A., Allen, E., Araujo, R., Aviles, E., Berno, A., Brennan, T., Carpenter, J., Chen, E., Cherry, J. M., Chung, E., Duncan, M., Guzman, E., Hartzell, G., Hunicke-Smith, S., Hyman, R. W., Kayser, A., Komp, C., Lashkari, D., Lew, H., Lin, D., Mosedale, D., Davis, R. W., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome V." Nature 387:78-81.9169868
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Graham, L. A., Trumpower, B. L. (1991). "Mutational analysis of the mitochondrial Rieske iron-sulfur protein of Saccharomyces cerevisiae. III. Import, protease processing, and assembly into the cytochrome bc1 complex of iron-sulfur protein lacking the iron-sulfur cluster." J Biol Chem 266:22485-22492.1657998
  • Gatti, D. L., Meinhardt, S. W., Ohnishi, T., Tzagoloff, A. (1989). "Structure and function of the mitochondrial bc1 complex. A mutational analysis of the yeast Rieske iron-sulfur protein." J Mol Biol 205:421-435.2538628
  • Hunte, C., Koepke, J., Lange, C., Rossmanith, T., Michel, H. (2000). "Structure at 2.3 A resolution of the cytochrome bc(1) complex from the yeast Saccharomyces cerevisiae co-crystallized with an antibody Fv fragment." Structure 8:669-684.10873857
  • Lange, C., Hunte, C. (2002). "Crystal structure of the yeast cytochrome bc1 complex with its bound substrate cytochrome c." Proc Natl Acad Sci U S A 99:2800-2805.11880631