You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameValyl-tRNA synthetase, mitochondrial
Synonyms
  • Valine--tRNA ligase
  • ValRS
Gene NameVAS1
Enzyme Class
Biological Properties
General FunctionInvolved in nucleotide binding
Specific FunctionATP + L-valine + tRNA(Val) = AMP + diphosphate + L-valyl-tRNA(Val)
Cellular LocationMitochondrion. Cytoplasm
SMPDB PathwaysNot Available
KEGG Pathways
Valine, leucine and isoleucine biosynthesisec00290 Map00290
SMPDB ReactionsNot Available
KEGG Reactions
Adenosine triphosphate + L-Valine + tRNA(Val) → Adenosine monophosphate + Pyrophosphate + Val-tRNA(Val)
Metabolites
YMDB IDNameView
YMDB00097Adenosine monophosphateShow
YMDB00109Adenosine triphosphateShow
YMDB00152L-ValineShow
YMDB00219PyrophosphateShow
GO Classification
Component
cell part
intracellular part
cytoplasm
Function
ligase activity, forming aminoacyl-tRNA and related compounds
aminoacyl-tRNA ligase activity
catalytic activity
nucleotide binding
ligase activity
binding
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
valine-tRNA ligase activity
adenyl ribonucleotide binding
ATP binding
ligase activity, forming carbon-oxygen bonds
Process
metabolic process
cellular macromolecule metabolic process
macromolecule metabolic process
RNA metabolic process
ncRNA metabolic process
biosynthetic process
tRNA metabolic process
tRNA aminoacylation
tRNA aminoacylation for protein translation
macromolecule biosynthetic process
cellular macromolecule biosynthetic process
translation
valyl-tRNA aminoacylation
Gene Properties
Chromosome Locationchromosome 7
LocusYGR094W
Gene Sequence>3315 bp ATGAATAAGTGGTTAAACACATTATCTAAGACATTCACTTTTCGGCTTTTGAACTGTCAT TATAGGCGATCATTACCACTTTGTCAAAACTTTTCTCTGAAGAAGTCGTTAACTCATAAT CAAGTCAGGTTCTTTAAAATGAGCGATCTTGATAATTTGCCTCCAGTTGACCCAAAGACT GGTGAGGTCATCATTAATCCGTTAAAGGAAGATGGCTCTCCAAAGACTCCTAAGGAAATT GAAAAAGAGAAGAAAAAGGCTGAAAAACTGTTAAAGTTCGCTGCCAAACAAGCTAAAAAA AATGCTGCTGCCACCACAGGTGCATCTCAAAAGAAACCTAAGAAAAAGAAGGAAGTTGAG CCAATCCCTGAATTTATTGACAAAACTGTTCCAGGTGAGAAAAAAATCTTAGTATCCTTG GATGATCCGGCTTTAAAAGGTTATAACCCTGCTAACGTTGAAAGTTCTTGGTATGACTGG TGGATCAAGACTGGTGTTTTTGAACCTGAATTTACCGCTGATGGTAAGGTTAAACCAGAA GGTGTATTTTGCATTCCAGCACCTCCACCAAACGTCACTGGTGCCTTACATATTGGTCAT GCTTTGACTATTGCTATCCAAGATTCTTTGATCAGATATAACAGAATGAAAGGTAAAACT GTCTTATTCTTGCCAGGTTTCGACCATGCTGGTATTGCTACTCAGTCCGTTGTGGAGAAG CAAATCTGGGCTAAGGACAGAAAGACTAGACATGACTATGGAAGAGAAGCTTTTGTTGGT AAGGTCTGGGAATGGAAAGAGGAATACCATAGCAGAATTAAGAACCAAATTCAAAAATTG GGGGCTTCTTATGATTGGAGCCGCGAAGCTTTCACTTTGAGTCCAGAATTGACCAAGTCT GTTGAAGAAGCTTTTGTTAGACTACATGATGAAGGTGTTATTTATCGTGCGTCCAGATTA GTTAATTGGTCTGTTAAATTGAATACCGCTATCTCTAATTTGGAAGTCGAAAATAAGGAC GTTAAAAGTAGAACGCTTTTATCAGTCCCAGGCTATGATGAAAAGGTTGAATTTGGTGTT TTAACATCATTTGCTTATCCAGTTATCGGTAGCGATGAAAAACTGATCATTGCTACAACT AGACCTGAAACTATATTTGGTGATACTGCCGTTGCAGTTCATCCTGATGATGACCGTTAC AAACACTTGCATGGTAAGTTCATCCAACATCCTTTCTTACCAAGAAAAATTCCAATTATC ACCGACAAGGAAGCTGTTGACATGGAATTCGGTACTGGTGCCGTTAAGATCACTCCAGCC CATGACCAAAACGATTACAATACCGGTAAGCGTCACAATTTGGAATTCATCAATATTTTG ACTGACGATGGTTTATTAAACGAGGAGTGTGGTCCAGAGTGGCAAGGCATGAAAAGGTTT GATGCCAGAAAGAAGGTCATTGAGCAGCTGAAGGAAAAGAACCTATACGTTGGCCAAGAA GATAATGAAATGACCATTCCAACTTGTTCCAGATCTGGTGACATTATTGAACCTTTATTG AAACCTCAATGGTGGGTTTCTCAAAGTGAAATGGCCAAAGATGCTATTAAGGTTGTTAAG GATGGTCAAATTACCATCACCCCCAAATCTTCTGAGGCTGAATATTTCCATTGGTTGGGT AACATCCAAGATTGGTGTATTTCCAGACAATTATGGTGGGGTCATCGTTGTCCAGTTTAC TTTATTAACATCGAAGGCGAAGAACACGATAGAATTGATGGTGACTATTGGGTTGCTGGT AGGAGCATGGAGGAAGCTGAAAAGAAGGCTGCTGCCAAATACCCTAATTCCAAATTTACT CTGGAACAAGATGAAGATGTTTTAGACACCTGGTTCTCGTCCGGTTTGTGGCCTTTCTCC ACTTTGGGTTGGCCAGAAAAGACTAAAGACATGGAAACTTTTTACCCATTTTCTATGTTG GAAACTGGTTGGGATATTCTTTTCTTCTGGGTTACTAGAATGATTCTATTGGGCTTAAAA TTGACCGGTTCAGTTCCATTCAAGGAAGTTTTCTGCCACTCTTTAGTCCGTGACGCTCAA GGTCGTAAGATGTCTAAATCTTTAGGTAATGTTATTGACCCACTAGACGTTATTACTGGT ATTAAGTTGGATGATTTGCATGCAAAATTATTACAAGGTAACTTAGATCCAAGAGAAGTT GAAAAAGCTAAGATCGGTCAAAAGGAATCCTACCCTAACGGTATTCCTCAATGTGGTACC GATGCTATGAGGTTTGCATTATGTGCTTATACCACTGGTGGTCGTGATATTAACTTAGAT ATCTTACGTGTCGAAGGTTACAGAAAGTTCTGTAACAAAATCTACCAAGCTACCAAGTTT GCATTGATGAGACTCGGTGACGATTATCAACCACCTGCCACTGAAGGTCTATCAGGTAAC GAATCCTTGGTTGAAAAATGGATCTTGCACAAGCTGACTGAAACCTCGAAAATTGTCAAT GAAGCTCTAGATAAACGTGACTTCTTGACGTCCACTAGCAGTATTTACGAATTCTGGTAT TTGATTTGTGATGTTTACATCGAGAACTCTAAATACTTGATTCAAGAAGGCTCTGCTATT GAAAAGAAGTCCGCAAAGGATACATTGTATATCTTGCTGGACAACGCTTTGAAATTAATC CACCCATTCATGCCATTCATTTCTGAAGAAATGTGGCAAAGACTTCCAAAGCGTTCCACT GAGAAGGCTGCCTCAATTGTAAAAGCTTCTTATCCAGTTTACGTATCTGAGTACGATGAT GTCAAATCGGCCAACGCTTACGACTTGGTCTTGAACATTACCAAAGAAGCTCGTTCCTTG TTATCTGAGTACAATATTTTGAAGAATGGTAAGGTTTTCGTTGAATCTAACCACGAGGAA TACTTCAAAACTGCTGAAGATCAGAAAGATTCTATTGTCTCGTTGATCAAGGCCATCGAC GAAGTCACTGTTGTTCGTGATGCTTCCGAAATTCCAGAAGGTTGCGTATTGCAATCTGTT AACCCAGAAGTCAATGTACATCTTCTCGTCAAGGGACACGTTGATATTGATGCTGAAATT GCGAAAGTTCAAAAGAAACTTGAAAAGGCTAAAAAATCCAAGAACGGTATTGAACAAACC ATTAACAGTAAGGATTACGAAACAAAGGCTAATACACAGGCCAAGGAAGCCAATAAAAGC AAGCTGGATAACACTGTTGCCGAAATCGAAGGTTTGGAAGCTACTATTGAAAACTTGAAG CGTTTGAAATTGTAG
Protein Properties
Pfam Domain Function
Protein Residues1104
Protein Molecular Weight125769.0
Protein Theoretical pI6.96
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Valyl-tRNA synthetase, mitochondrial MNKWLNTLSKTFTFRLLNCHYRRSLPLCQNFSLKKSLTHNQVRFFKMSDLDNLPPVDPKT GEVIINPLKEDGSPKTPKEIEKEKKKAEKLLKFAAKQAKKNAAATTGASQKKPKKKKEVE PIPEFIDKTVPGEKKILVSLDDPALKAYNPANVESSWYDWWIKTGVFEPEFTADGKVKPE GVFCIPAPPPNVTGALHIGHALTIAIQDSLIRYNRMKGKTVLFLPGFDHAGIATQSVVEK QIWAKDRKTRHDYGREAFVGKVWEWKEEYHSRIKNQIQKLGASYDWSREAFTLSPELTKS VEEAFVRLHDEGVIYRASRLVNWSVKLNTAISNLEVENKDVKSRTLLSVPGYDEKVEFGV LTSFAYPVIGSDEKLIIATTRPETIFGDTAVAVHPDDDRYKHLHGKFIQHPFLPRKIPII TDKEAVDMEFGTGAVKITPAHDQNDYNTGKRHNLEFINILTDDGLLNEECGPEWQGMKRF DARKKVIEQLKEKNLYVGQEDNEMTIPTCSRSGDIIEPLLKPQWWVSQSEMAKDAIKVVR DGQITITPKSSEAEYFHWLGNIQDWCISRQLWWGHRCPVYFINIEGEEHDRIDGDYWVAG RSMEEAEKKAAAKYPNSKFTLEQDEDVLDTWFSSGLWPFSTLGWPEKTKDMETFYPFSML ETGWDILFFWVTRMILLGLKLTGSVPFKEVFCHSLVRDAQGRKMSKSLGNVIDPLDVITG IKLDDLHAKLLQGNLDPREVEKAKIGQKESYPNGIPQCGTDAMRFALCAYTTGGRDINLD ILRVEGYRKFCNKIYQATKFALMRLGDDYQPPATEGLSGNESLVEKWILHKLTETSKIVN EALDKRDFLTSTSSIYEFWYLICDVYIENSKYLIQEGSAIEKKSAKDTLYILLDNALKLI HPFMPFISEEMWQRLPKRSTEKAASIVKASYPVYVSEYDDVKSANAYDLVLNITKEARSL LSEYNILKNGKVFVESNHEEYFKTAEDQKDSIVSLIKAIDEVTVVRDASEIPEGCVLQSV NPEVNVHLLVKGHVDIDAEIAKVQKKLEKAKKSKNGIEQTINSKDYETKANTQAKEANKS KLDNTVAEIEGLEATIENLKRLKL
References
External Links
ResourceLink
Saccharomyces Genome Database VAS1
Uniprot IDP07806
Uniprot NameSYV_YEAST
GenBank Gene IDJ02719
Genebank Protein ID173164
General Reference
  • Jordana, X., Chatton, B., Paz-Weisshaar, M., Buhler, J. M., Cramer, F., Ebel, J. P., Fasiolo, F. (1987). "Structure of the yeast valyl-tRNA synthetase gene (VASI) and the homology of its translated amino acid sequence with Escherichia coli isoleucyl-tRNA synthetase." J Biol Chem 262:7189-7194.3294828
  • Tettelin, H., Agostoni Carbone, M. L., Albermann, K., Albers, M., Arroyo, J., Backes, U., Barreiros, T., Bertani, I., Bjourson, A. J., Bruckner, M., Bruschi, C. V., Carignani, G., Castagnoli, L., Cerdan, E., Clemente, M. L., Coblenz, A., Coglievina, M., Coissac, E., Defoor, E., Del Bino, S., Delius, H., Delneri, D., de Wergifosse, P., Dujon, B., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome VII." Nature 387:81-84.9169869
  • Chatton, B., Walter, P., Ebel, J. P., Lacroute, F., Fasiolo, F. (1988). "The yeast VAS1 gene encodes both mitochondrial and cytoplasmic valyl-tRNA synthetases." J Biol Chem 263:52-57.3275649
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956