You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameInvertase 7
Synonyms
  • Beta-fructofuranosidase 7
  • Saccharase
  • Fragments
Gene NameSUC7
Enzyme Class
Biological Properties
General FunctionInvolved in hydrolase activity, hydrolyzing O-glycosyl compounds
Specific FunctionHydrolysis of terminal non-reducing beta-D- fructofuranoside residues in beta-D-fructofuranosides
Cellular LocationCytoplasmic
SMPDB Pathways
Starch and sucrose metabolismPW002481 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Galactose metabolismec00052 Map00052
Starch and sucrose metabolismec00500 Map00500
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00286D-GlucoseShow
YMDB00657D-FructoseShow
YMDB00890waterShow
YMDB00906SucroseShow
GO Classification
Component
Not Available
Function
hydrolase activity
hydrolase activity, acting on glycosyl bonds
hydrolase activity, hydrolyzing O-glycosyl compounds
catalytic activity
Process
metabolic process
primary metabolic process
carbohydrate metabolic process
Gene Properties
Chromosome Locationchromosome 8
LocusSUC7
Gene Sequence>gi|4576|emb|X02908.1| Yeast suc7 gene 5' region for invertase TGCACAGTGGAAACTACTTCTAGATGCGTAATTCTGGAAGGACAAACGGAAGAGGAAAAA AAGAGGACACAACGATAGTAAAAGACATCTAAAATTTTCTTTGATTCAAAACGTGATCTC TCAACTTTGATGTCCACTGAATTCCTTTTCCGGATTGCAAACATCATTAATGCAATCAGT GAGCAAATCTGGAGAGAGTGATTCATTTTATAATTTAGGAATCCCGCATGTTGCAAGAAA GACAGTAGGTGCTGAATATACTTTACTTAAGATGAAATAGTCCGTTTTTTTCCTCCGCTT TTTTCTCACGTGGAGCGGAAATAAAAAATTGTCTTCGAAAATTATCCGGGGCAAAGAAAT GGGCGTAGGATTTCTCAACCCCACTTTTTGTGAAGTTTTTCCCCGGAAAATTCTGTGGAA CAATATTGTTGCGCAATGATTATTGAGCCTATTTCAACAGATTATTCAGGTACAGATACC TTCTACGTAAAAAAAAAAAAGTGATATTGCCTGTCAAAGAAAACTCAATAGTAAACAATC TGGAAGAGGGTGAGAGAAATTAAATGACTTTTTTGGGCTGTGATCATAGAATTCCATTTT CCTCAAAGAGAAACGTACAAATAGATATATGTATTGTTTCTTTTAAAACATTCTCTTGTT CTTGTGCTTTTTTTCTTTTTCTTTTTCTCTCAGTGAAACAAGCAAAACAAAAAGCTTTTC CTTTCACTAACGTATATGATGCTTTTGCAAGCTTTCATTTTCCTTTTGGCTGGCTTTGCA GCTAAGATATCAGCATTAATGACAAACGAAACTAGCGATAGACCTTTGGTCCACTTCACC CCCAACAAGGGTTGGATGAATGATCCAAATGGATTGTGGTACGATGCAAAAGAAGGTAAA TGGCATCTCTACTTTCAGTACAATCCAAATGACACTGTTTGGGGTTTGCCACTCTTCTGG
Protein Properties
Pfam Domain Function
Protein Residues96
Protein Molecular Weight11248.90039
Protein Theoretical pI6.52
Signalling Regions
  • 1-19
Transmembrane Regions
  • None
Protein Sequence>Invertase 7 MLLQAFIFLLAGFAAKISALMTNETSDRPLVHFTPNKGWMNDPNGLWYDAKEGKWHLYFQ YNPNDTVWGLPLFWVNMTTGVDNLFYIDKFQVREVK
References
External Links
ResourceLink
Saccharomyces Genome Database SUC7
Uniprot IDP07635
Uniprot NameINV7_YEAST
General Reference
  • Sarokin, L., Carlson, M. (1985). "Comparison of two yeast invertase genes: conservation of the upstream regulatory region." Nucleic Acids Res 13:6089-6103.3900928