You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameN-terminal acetyltransferase A complex catalytic subunit ARD1
Synonyms
  • NatA complex subunit ARD1
  • Arrest-defective protein 1
Gene NameARD1
Enzyme Class
Biological Properties
General FunctionInvolved in N-acetyltransferase activity
Specific FunctionCatalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala. N-acetylation plays a role in normal eukaryotic translation and processing, protect against proteolytic degradation and protein turnover
Cellular LocationCytoplasm
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00045Coenzyme AShow
YMDB00312Acetyl-CoAShow
GO Classification
Component
Not Available
Function
transferase activity, transferring acyl groups
transferase activity, transferring acyl groups other than amino-acyl groups
acyltransferase activity
acetyltransferase activity
N-acetyltransferase activity
catalytic activity
transferase activity
Process
metabolic process
Gene Properties
Chromosome Locationchromosome 8
LocusYHR013C
Gene Sequence>717 bp ATGCCTATTAATATTCGCAGAGCGACAATCAATGACATTATATGTATGCAAAATGCCAAC CTTCATAACCTACCCGAAAATTATATGATGAAATATTATATGTATCATATTCTCTCGTGG CCAGAGGCTTCGTTTGTTGCTACTACCACCACTTTGGACTGTGAAGATAGTGATGAACAA GATGAGAACGACAAATTGGAATTGACCTTAGATGGGACCAATGACGGCAGGACAATCAAG TTGGATCCAACATACTTGGCTCCGGGCGAAAAATTAGTTGGATACGTTCTCGTGAAGATG AACGACGACCCCGACCAGCAAAACGAGCCACCAAATGGTCATATTACTTCCTTAAGTGTC ATGAGAACCTATAGAAGGATGGGGATTGCCGAAAACTTAATGAGACAAGCTTTATTTGCG TTGAGAGAAGTTCATCAAGCGGAATATGTTTCCTTGCATGTGAGACAATCTAATAGAGCA GCTTTACACTTGTACAGGGACACATTGGCGTTTGAGGTGTTGAGTATCGAGAAAAGCTAC TATCAGGATGGTGAAGATGCATACGCCATGAAGAAGGTTTTAAAATTAGAGGAGTTGCAG ATAAGCAACTTCACCCATCGCCGTTTGAAAGAGAATGAGGAAAAACTAGAAGACGATCTA GAAAGCGATCTACTAGAGGATATCATTAAGCAAGGCGTAAATGATATCATTGTATAA
Protein Properties
Pfam Domain Function
Protein Residues238
Protein Molecular Weight27602.90039
Protein Theoretical pI4.52
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>N-terminal acetyltransferase A complex catalytic subunit ARD1 MPINIRRATINDIICMQNANLHNLPENYMMKYYMYHILSWPEASFVATTTTLDCEDSDEQ DENDKLELTLDGTNDGRTIKLDPTYLAPGEKLVGYVLVKMNDDPDQQNEPPNGHITSLSV MRTYRRMGIAENLMRQALFALREVHQAEYVSLHVRQSNRAALHLYRDTLAFEVLSIEKSY YQDGEDAYAMKKVLKLEELQISNFTHRRLKENEEKLEDDLESDLLEDIIKQGVNDIIV
References
External Links
ResourceLink
Saccharomyces Genome Database ARD1
Uniprot IDP07347
Uniprot NameARD1_YEAST
GenBank Gene IDAY557822
Genebank Protein ID45269535
General Reference
  • Whiteway, M., Szostak, J. W. (1985). "The ARD1 gene of yeast functions in the switch between the mitotic cell cycle and alternative developmental pathways." Cell 43:483-492.3907857
  • Johnston, M., Andrews, S., Brinkman, R., Cooper, J., Ding, H., Dover, J., Du, Z., Favello, A., Fulton, L., Gattung, S., et, a. l. .. (1994). "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome VIII." Science 265:2077-2082.8091229
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Mullen, J. R., Kayne, P. S., Moerschell, R. P., Tsunasawa, S., Gribskov, M., Colavito-Shepanski, M., Grunstein, M., Sherman, F., Sternglanz, R. (1989). "Identification and characterization of genes and mutants for an N-terminal acetyltransferase from yeast." EMBO J 8:2067-2075.2551674
  • Park, E. C., Szostak, J. W. (1992). "ARD1 and NAT1 proteins form a complex that has N-terminal acetyltransferase activity." EMBO J 11:2087-2093.1600941
  • Gautschi, M., Just, S., Mun, A., Ross, S., Rucknagel, P., Dubaquie, Y., Ehrenhofer-Murray, A., Rospert, S. (2003). "The yeast N(alpha)-acetyltransferase NatA is quantitatively anchored to the ribosome and interacts with nascent polypeptides." Mol Cell Biol 23:7403-7414.14517307
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106