You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePhosphomannomutase
Synonyms
  • PMM
Gene NameSEC53
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionInvolved in the synthesis of the GDP-mannose and dolichol-phosphate-mannose required for a number of critical mannosyl transfer reactions
Cellular LocationCytoplasm
SMPDB Pathways
Amino sugar and nucleotide sugar metabolismPW002413 ThumbThumb?image type=greyscaleThumb?image type=simple
Mannose MetabolismPW002391 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Amino sugar and nucleotide sugar metabolismec00520 Map00520
Fructose and mannose metabolismec00051 Map00051
SMPDB Reactions
Mannose 6-phosphateD-Mannose 1-phosphate
KEGG Reactions
D-Mannose 1-phosphateD-mannose 6-phosphate
Metabolites
YMDB IDNameView
YMDB00242Mannose 6-phosphateShow
YMDB00386D-Mannose 1-phosphateShow
YMDB00966D-mannose 6-phosphateShow
GO Classification
Component
cell part
intracellular part
cytoplasm
Function
intramolecular transferase activity
intramolecular transferase activity, phosphotransferases
phosphomannomutase activity
catalytic activity
isomerase activity
Process
mannose metabolic process
mannose biosynthetic process
metabolic process
small molecule metabolic process
alcohol metabolic process
monosaccharide metabolic process
hexose metabolic process
Gene Properties
Chromosome Locationchromosome 6
LocusYFL045C
Gene Sequence>765 bp ATGAGTATCGCTGAATTCGCTTACAAGGAAAAACCAGAAACTTTGGTTTTATTCGATGTT GATGGTACCTTGACACCAGCCAGATTAACTGTTTCTGAAGAAGTTAGAAAAACTTTGGCC AAGTTGAGAAACAAGTGCTGCATTGGTTTTGTCGGTGGTTCTGACTTAAGCAAGCAATTA GAACAGTTAGGCCCAAACGTCTTAGATGAATTTGACTATTCTTTCTCTGAAAATGGTTTG ACCGCCTACAGATTAGGTAAGGAATTAGCTTCTCAATCCTTCATCAACTGGCTCGGTGAG GAAAAATACAATAAATTGGCCGTCTTCATTTTGAGATATCTATCTGAAATTGACTTGCCA AAGAGAAGAGGTACTTTCTTGGAATTTAGAAATGGTATGATCAACGTTTCCCCAATTGGT AGAAATGCTTCTACTGAGGAAAGAAACGAATTCGAAAGATACGATAAGGAACACCAAATC AGAGCTAAGTTCGTTGAAGCTTTGAAAAAGGAATTCCCAGACTACGGTTTGACTTTCTCC ATTGGTGGCCAAATCTCTTTCGACGTTTTCCCCGCTGGTTGGGATAAGACCTACTGTTTG CAACACGTTGAAAAAGATGGTTTCAAGGAAATTCATTTCTTTGGTGACAAGACTATGGTC GGTGGTAACGATTACGAAATTTTTGTCGATGAAAGAACCATCGGACATTCAGTACAATCT CCTGATGACACCGTCAAAATTTTGACTGAACTATTCAACTTATAG
Protein Properties
Pfam Domain Function
Protein Residues254
Protein Molecular Weight29062.69922
Protein Theoretical pI4.88
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Phosphomannomutase MSIAEFAYKEKPETLVLFDVDGTLTPARLTVSEEVRKTLAKLRNKCCIGFVGGSDLSKQL EQLGPNVLDEFDYSFSENGLTAYRLGKELASQSFINWLGEEKYNKLAVFILRYLSEIDLP KRRGTFLEFRNGMINVSPIGRNASTEERNEFERYDKEHQIRAKFVEALKKEFPDYGLTFS IGGQISFDVFPAGWDKTYCLQHVEKDGFKEIHFFGDKTMVGGNDYEIFVDERTIGHSVQS PDDTVKILTELFNL
References
External Links
ResourceLink
Saccharomyces Genome Database SEC53
Uniprot IDP07283
Uniprot NamePMM_YEAST
GenBank Gene IDAJ585720
Genebank Protein ID45720044
General Reference
  • Bernstein, M., Hoffmann, W., Ammerer, G., Schekman, R. (1985). "Characterization of a gene product (Sec53p) required for protein assembly in the yeast endoplasmic reticulum." J Cell Biol 101:2374-2382.3905826
  • Leh-Louis, V., Wirth, B., Despons, L., Wain-Hobson, S., Potier, S., Souciet, J. L. (2004). "Differential evolution of the Saccharomyces cerevisiae DUP240 paralogs and implication of recombination in phylogeny." Nucleic Acids Res 32:2069-2078.15087486
  • Murakami, Y., Naitou, M., Hagiwara, H., Shibata, T., Ozawa, M., Sasanuma, S., Sasanuma, M., Tsuchiya, Y., Soeda, E., Yokoyama, K., et, a. l. .. (1995). "Analysis of the nucleotide sequence of chromosome VI from Saccharomyces cerevisiae." Nat Genet 10:261-268.7670463
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Kepes, F., Schekman, R. (1988). "The yeast SEC53 gene encodes phosphomannomutase." J Biol Chem 263:9155-9161.3288631
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Li, X., Gerber, S. A., Rudner, A. D., Beausoleil, S. A., Haas, W., Villen, J., Elias, J. E., Gygi, S. P. (2007). "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae." J Proteome Res 6:1190-1197.17330950
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956