You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameMevalonate kinase
Synonyms
  • MK
  • MvK
  • Ergosterol biosynthesis protein 12
  • Regulation of autonomous replication protein 1
Gene NameERG12
Enzyme Class
Biological Properties
General FunctionInvolved in ATP binding
Specific FunctionRAR (regulation of autonomous replication) is a protein whose activity increases the mitotic stability of plasmids
Cellular LocationCytoplasm
SMPDB Pathways
Cholesterol biosynthesis and metabolism CE(10:0)PW002545 ThumbThumb?image type=greyscaleThumb?image type=simple
Cholesterol biosynthesis and metabolism CE(12:0)PW002548 ThumbThumb?image type=greyscaleThumb?image type=simple
Cholesterol biosynthesis and metabolism CE(14:0)PW002544 ThumbThumb?image type=greyscaleThumb?image type=simple
Cholesterol biosynthesis and metabolism CE(16:0)PW002550 ThumbThumb?image type=greyscaleThumb?image type=simple
Cholesterol biosynthesis and metabolism CE(18:0)PW002551 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Terpenoid backbone biosynthesisec00900 Map00900
SMPDB Reactions
(R)-Mevalonic acid + Adenosine triphosphateMevalonic acid-5P + ADP
KEGG Reactions
Adenosine triphosphate + (R)-Mevalonic acidMevalonic acid-5P + hydron + ADP
(R)-Mevalonic acid + Cytidine triphosphateMevalonic acid-5P + CDP + hydron
GTP + (R)-Mevalonic acidMevalonic acid-5P + hydron + Guanosine diphosphate
Uridine triphosphate + (R)-Mevalonic acidMevalonic acid-5P + Uridine 5'-diphosphate + hydron
Metabolites
YMDB IDNameView
YMDB00064CDPShow
YMDB00109Adenosine triphosphateShow
YMDB00181Mevalonic acid-5PShow
YMDB00257Guanosine diphosphateShow
YMDB00279Cytidine triphosphateShow
YMDB00307Uridine 5'-diphosphateShow
YMDB0031022b-HydroxycholesterolShow
YMDB00326Uridine triphosphateShow
YMDB00558GTPShow
YMDB00707(R)-Mevalonic acidShow
YMDB00862hydronShow
YMDB00914ADPShow
YMDB01039(R)-MevalonateShow
GO Classification
Component
intracellular part
cytoplasm
cell part
Function
transferase activity, transferring phosphorus-containing groups
kinase activity
phosphotransferase activity, alcohol group as acceptor
binding
nucleoside binding
catalytic activity
purine nucleoside binding
transferase activity
adenyl nucleotide binding
adenyl ribonucleotide binding
mevalonate kinase activity
ATP binding
Process
cellular metabolic process
phosphorus metabolic process
primary metabolic process
phosphate metabolic process
phosphorylation
lipid metabolic process
cellular lipid metabolic process
isoprenoid metabolic process
isoprenoid biosynthetic process
metabolic process
Gene Properties
Chromosome Locationchromosome 13
LocusYMR208W
Gene Sequence>1332 bp ATGTCATTACCGTTCTTAACTTCTGCACCGGGAAAGGTTATTATTTTTGGTGAACACTCT GCTGTGTACAACAAGCCTGCCGTCGCTGCTAGTGTGTCTGCGTTGAGAACCTACCTGCTA ATAAGCGAGTCATCTGCACCAGATACTATTGAATTGGACTTCCCGGACATTAGCTTTAAT CATAAGTGGTCCATCAATGATTTCAATGCCATCACCGAGGATCAAGTAAACTCCCAAAAA TTGGCCAAGGCTCAACAAGCCACCGATGGCTTGTCTCAGGAACTCGTTAGTCTTTTGGAT CCGTTGTTAGCTCAACTATCCGAATCCTTCCACTACCATGCAGCGTTTTGTTTCCTGTAT ATGTTTGTTTGCCTATGCCCCCATGCCAAGAATATTAAGTTTTCTTTAAAGTCTACTTTA CCCATCGGTGCTGGGTTGGGCTCAAGCGCCTCTATTTCTGTATCACTGGCCTTAGCTATG GCCTACTTGGGGGGGTTAATAGGATCTAATGACTTGGAAAAGCTGTCAGAAAACGATAAG CATATAGTGAATCAATGGGCCTTCATAGGTGAAAAGTGTATTCACGGTACCCCTTCAGGA ATAGATAACGCTGTGGCCACTTATGGTAATGCCCTGCTATTTGAAAAAGACTCACATAAT GGAACAATAAACACAAACAATTTTAAGTTCTTAGATGATTTCCCAGCCATTCCAATGATC CTAACCTATACTAGAATTCCAAGGTCTACAAAAGATCTTGTTGCTCGCGTTCGTGTGTTG GTCACCGAGAAATTTCCTGAAGTTATGAAGCCAATTCTAGATGCCATGGGTGAATGTGCC CTACAAGGCTTAGAGATCATGACTAAGTTAAGTAAATGTAAAGGCACCGATGACGAGGCT GTAGAAACTAATAATGAACTGTATGAACAACTATTGGAATTGATAAGAATAAATCATGGA CTGCTTGTCTCAATCGGTGTTTCTCATCCTGGATTAGAACTTATTAAAAATCTGAGCGAT GATTTGAGAATTGGCTCCACAAAACTTACCGGTGCTGGTGGCGGCGGTTGCTCTTTGACT TTGTTACGAAGAGACATTACTCAAGAGCAAATTGACAGCTTCAAAAAGAAATTGCAAGAT GATTTTAGTTACGAGACATTTGAAACAGACTTGGGTGGGACTGGCTGCTGTTTGTTAAGC GCAAAAAATTTGAATAAAGATCTTAAAATCAAATCCCTAGTATTCCAATTATTTGAAAAT AAAACTACCACAAAGCAACAAATTGACGATCTATTATTGCCAGGAAACACGAATTTACCA TGGACTTCATAA
Protein Properties
Pfam Domain Function
Protein Residues443
Protein Molecular Weight48458.89844
Protein Theoretical pI5.28
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Mevalonate kinase MSLPFLTSAPGKVIIFGEHSAVYNKPAVAASVSALRTYLLISESSAPDTIELDFPDISFN HKWSINDFNAITEDQVNSQKLAKAQQATDGLSQELVSLLDPLLAQLSESFHYHAAFCFLY MFVCLCPHAKNIKFSLKSTLPIGAGLGSSASISVSLALAMAYLGGLIGSNDLEKLSENDK HIVNQWAFIGEKCIHGTPSGIDNAVATYGNALLFEKDSHNGTINTNNFKFLDDFPAIPMI LTYTRIPRSTKDLVARVRVLVTEKFPEVMKPILDAMGECALQGLEIMTKLSKCKGTDDEA VETNNELYEQLLELIRINHGLLVSIGVSHPGLELIKNLSDDLRIGSTKLTGAGGGGCSLT LLRRDITQEQIDSFKKKLQDDFSYETFETDLGGTGCCLLSAKNLNKDLKIKSLVFQLFEN KTTTKQQIDDLLLPGNTNLPWTS
References
External Links
ResourceLink
Saccharomyces Genome Database ERG12
Uniprot IDP07277
Uniprot NameKIME_YEAST
GenBank Gene IDX06114
Genebank Protein ID4287
General Reference
  • Kearsey, S. E., Edwards, J. (1987). "Mutations that increase the mitotic stability of minichromosomes in yeast: characterization of RAR1." Mol Gen Genet 210:509-517.3323847
  • Oulmouden, A., Karst, F. (1991). "Nucleotide sequence of the ERG12 gene of Saccharomyces cerevisiae encoding mevalonate kinase." Curr Genet 19:9-14.1645230
  • Bowman, S., Churcher, C., Badcock, K., Brown, D., Chillingworth, T., Connor, R., Dedman, K., Devlin, K., Gentles, S., Hamlin, N., Hunt, S., Jagels, K., Lye, G., Moule, S., Odell, C., Pearson, D., Rajandream, M., Rice, P., Skelton, J., Walsh, S., Whitehead, S., Barrell, B. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XIII." Nature 387:90-93.9169872
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106