You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameDelta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial
Synonyms
  • P5C dehydrogenase
Gene NamePUT2
Enzyme Class
Biological Properties
General FunctionInvolved in oxidoreductase activity
Specific Function(S)-1-pyrroline-5-carboxylate + NAD(P)(+) + 2 H(2)O = L-glutamate + NAD(P)H
Cellular LocationMitochondrion inner membrane
SMPDB Pathways
4-aminobutanoate degradationPW002382 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Alanine, aspartate and glutamate metabolismec00250 Map00250
Arginine and proline metabolismec00330 Map00330
SMPDB Reactions
Succinic acid semialdehyde + NAD + waterSuccinic acid + NADH + hydron
KEGG Reactions
NADP + water + l-Glutamic-gamma-semialdehydeL-Glutamic acid + NADPH + hydron
water + NAD + 1-pyrroline-3-hydroxy-5-carboxylic acidNADH + hydron + erythro-4-hydroxy-L-glutamic acid
NAD + water + L-4-hydroxyglutamic semialdehydeNADH + hydron + erythro-4-hydroxy-L-glutamic acid
NAD + trans-4-hydroxy-L-prolineNADH + hydron + 1-pyrroline-3-hydroxy-5-carboxylic acid
NADP + trans-4-hydroxy-L-prolineNADPH + hydron + 1-pyrroline-3-hydroxy-5-carboxylic acid
Metabolites
YMDB IDNameView
YMDB00110NADShow
YMDB00143NADHShow
YMDB00236Succinic acid semialdehydeShow
YMDB002431-Pyrroline-5-carboxylic acidShow
YMDB00271L-Glutamic acidShow
YMDB00338Succinic acidShow
YMDB00412NAD(+)Show
YMDB00426NADPHShow
YMDB00427NADPShow
YMDB007181-pyrroline-3-hydroxy-5-carboxylic acidShow
YMDB00719erythro-4-hydroxy-L-glutamic acidShow
YMDB00720L-4-hydroxyglutamic semialdehydeShow
YMDB00723trans-4-hydroxy-L-prolineShow
YMDB00862hydronShow
YMDB00890waterShow
YMDB00918l-Glutamic-gamma-semialdehydeShow
GO Classification
Component
cytoplasmic part
mitochondrial part
mitochondrial matrix
intracellular part
cell part
Function
1-pyrroline-5-carboxylate dehydrogenase activity
oxidoreductase activity
oxidoreductase activity, acting on the CH-NH group of donors
catalytic activity
oxidoreductase activity, acting on the CH-NH group of donors, NAD or NADP as acceptor
Process
cellular amino acid and derivative metabolic process
cellular amino acid metabolic process
glutamine family amino acid metabolic process
oxidation reduction
metabolic process
proline metabolic process
proline biosynthetic process
cellular metabolic process
Gene Properties
Chromosome Locationchromosome 8
LocusYHR037W
Gene Sequence>1728 bp ATGCTATCAGCAAGGTGCCTCAAATCTATATACTTCAAGAGATCTTTCTCACAACTGGGA CACATCAAGCCCCCCAAGCACATAAGAAATGAACCTGTTAAGCCATTTAGAAACATAGAC TTAAAAGACTGGGACTTACTGAGGGCTTCCTTGATGAAATTCAAAAGTTCTTCTTTAGAA GTGCCACTGGTCATCAATGGGGAAAGGATATATGACAATAATGAAAGAGCGCTTTTCCCG CAGACTAACCCTGCGAACCATCAACAAGTACTGGCAAACGTCACACAAGCCACGGAAAAA GATGTCATGAATGCTGTAAAAGCCGCCAAGGATGCCAAAAAGGATTGGTACAATCTACCG TTTTATGACAGATCTGCAATTTTTTTGAAAGCCGCTGACTTAATTTCCACCAAGTATCGT TATGACATGTTAGCTGCTACAATGCTGGGCCAGGGAAAAAATGTGTATCAGGCAGAAATC GACTGTATCACGGAATTATCTGACTTTTTTAGATACTATGTCAAGTATGCATCAGACTTG TATGCTCAACAACCCGTGAGTCGAGCGGATGGTACTTGGAATAAAGCTGAATACAGACCT TTAGAGGGATTTGTGTATGCTGTTTCACCATTCAACTTTACTGCTATTGCTGCAAACTTG ATTGGGGCTCCAGCTTTGATGGGTAATACAGTTGTCTGGAAACCTTCACAAACCGCTGCC CTTTCAAATTACTTATTGATGACTGTTTTGGAAGAAGCGGGATTGCCAAAGGGTGTCATA AATTTCATTCTAGGTGATCCAGTTCAAGTTACTGACCAGGTATTAGCTGATAAAGATTTT GGTGCCTTGCATTTTACCGGTTCTACAAATGTCTTTAAGAGTTTGTATGGCAAAATACAA AGTGGCGTTGTTGAAGGGAAGTACAGAGATTACCCCCGTATTATTGGTGAGACAGGTGGT AAAAATTTCCATCTAGTTCACCCAAGTGCAAATATATCACATGCAGTACTCTCTACTATT AGAGGCACTTTCGAGTTCCAAGGCCAAAAGTGCTCTGCCGCTTCTAGGTTATATCTTCCA GAGTCAAAAAGTGAAGAATTCTTATCCGATATGTTTGGCATATTGCAGTCACAGAATGTT GTCCCAATGAACACATCCGCAAGTCCAATTTCTGGTGGGAATTTGCGGGGATTTATGGGT CCTGTCATCCATGAACAAAGTTTCGACAAATTAGTTAAAGTAATTGAAGATGCAAAGAAA GACCCCGAGTTGGAAATTCTTTACGGTGGACAATACGATAAAAGCCAAGGTTGGTTTGTC GGACCCACAGTCATAAAAGCCAAGAGACCAGATCATCCATATATGTCAACAGAATTTTTT GGCCCTATATTAACTGTTTACGAGTATCCAGATACGGAATTTAATGAAATCTGTGATATT ATCGATAATACGAGTCAATACGCCTTAACTGGTGCTATTTTTGCCAAAGATCGTAAAGCA ATTGAATACGCAGATGAGAAGTTGAAGTTTAGCGCAGGAAATTTCTACATAAATGATAAG TGTACTGGTGCCGTTGTTTCTCAGCAATGGTTTGGTGGCGCAAGAATGAGTGGTACCGAC GGTAAGGCTGGTGGTCCAAACATTTTAAGCAGATTTGTCAGTATTAGAAACACAAAGGAG AGCTTCTACGAGTTGACTGATTTCAAATATCCATCGAATTATGAATAA
Protein Properties
Pfam Domain Function
Protein Residues575
Protein Molecular Weight64434.60156
Protein Theoretical pI7.0
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Delta-1-pyrroline-5-carboxylate dehydrogenase, mitochondrial MLSARCLKSIYFKRSFSQLGHIKPPKHIRNEPVKPFRNIDLKDWDLLRASLMKFKSSSLE VPLVINGERIYDNNERALFPQTNPANHQQVLANVTQATEKDVMNAVKAAKDAKKDWYNLP FYDRSAIFLKAADLISTKYRYDMLAATMLGQGKNVYQAEIDCITELSDFFRYYVKYASDL YAQQPVESADGTWNKAEYRPLEGFVYAVSPFNFTAIAANLIGAPALMGNTVVWKPSQTAA LSNYLLMTVLEEAGLPKGVINFIPGDPVQVTDQVLADKDFGALHFTGSTNVFKSLYGKIQ SGVVEGKYRDYPRIIGETGGKNFHLVHPSANISHAVLSTIRGTFEFQGQKCSAASRLYLP ESKSEEFLSDMFGILQSQNVVPMNTSASPISGGNLRGFMGPVIHEQSFDKLVKVIEDAKK DPELEILYGGQYDKSQGWFVGPTVIKAKRPDHPYMSTEFFGPILTVYEYPDTEFNEICDI IDNTSQYALTGAIFAKDRKAIEYADEKLKFSAGNFYINDKCTGAVVSQQWFGGARMSGTD DKAGGPNILSRFVSIRNTKENFYELTDFKYPSNYE
References
External Links
ResourceLink
Saccharomyces Genome Database PUT2
Uniprot IDP07275
Uniprot NamePUT2_YEAST
GenBank Gene IDM10029
Genebank Protein ID172303
General Reference
  • Krzywicki, K. A., Brandriss, M. C. (1984). "Primary structure of the nuclear PUT2 gene involved in the mitochondrial pathway for proline utilization in Saccharomyces cerevisiae." Mol Cell Biol 4:2837-2842.6098824
  • Johnston, M., Andrews, S., Brinkman, R., Cooper, J., Ding, H., Dover, J., Du, Z., Favello, A., Fulton, L., Gattung, S., et, a. l. .. (1994). "Complete nucleotide sequence of Saccharomyces cerevisiae chromosome VIII." Science 265:2077-2082.8091229
  • Siddiqui, A. H., Brandriss, M. C. (1988). "A regulatory region responsible for proline-specific induction of the yeast PUT2 gene is adjacent to its TATA box." Mol Cell Biol 8:4634-4641.3062363
  • Grandier-Vazeille, X., Bathany, K., Chaignepain, S., Camougrand, N., Manon, S., Schmitter, J. M. (2001). "Yeast mitochondrial dehydrogenases are associated in a supramolecular complex." Biochemistry 40:9758-9769.11502169
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106