You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameAlpha-glucosidase MAL62
Synonyms
  • Maltase
Gene NameMAL62
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionHydrolysis of terminal, non-reducing (1->4)- linked alpha-D-glucose residues with release of alpha-D-glucose
Cellular LocationNot Available
SMPDB Pathways
Starch and sucrose metabolismPW002481 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Galactose metabolismec00052 Map00052
Starch and sucrose metabolismec00500 Map00500
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
YMDB00273Alpha-D-GlucoseShow
YMDB00584MaltoseShow
YMDB00890waterShow
GO Classification
Component
Not Available
Function
binding
ion binding
cation binding
catalytic activity
Process
primary metabolic process
carbohydrate metabolic process
metabolic process
Gene Properties
Chromosome LocationNot Available
LocusMAL62
Gene Sequence>1755 bp ATGACTATTTCTGATCATCCAGAAACAGAACCAAAGTGGTGGAAAGAGGCCACAATCTAT CAAATTTACCCAGCAAGTTTTAAAGACTCCAATAACGATGGCTGGGGTGATTTAAAAGGT ATCACTTCCAAGTTGCAGTATATTAAAGATCTTGGCGTTGATGCTATTTGGGTTTGTCCG TTTTATGACTCTCCTCAACAAGATATGGGGTATGATATATCCAACTACGAAAAGGTCTGG CCCACATACGGTACCAATGAGGACTGTTTTGAGCTAATTGACAAGACTCATAAGCTGGGT ATGAAATTCATCACCGATTTGGTTATCAACCACTGTTCTACAGAACACGAATGGTTCAAA GAGAGCAGATCCTCGAAGACCAATCCGAAGCGTGACTGGTTCTTCTGGAGACCTCCTAAG GGTTATGACGCCGAAGGCAAGCCAATTCCTCCAAACAATTGGAAATCTTTCTTTGGTGGT TCAGCTTGGACTTTTGATGAAACTACAAATGAATTTTACCTCCGTTTGTTTGCGAGTCGT CAAGTTGACTTGAATTGGGAGAATGAAGACTGCAGAAGGGCAATCTTTGAAAGTGCTGTT GGATTTTGGCTGGACCATGGTGTAGATGGTTTTAGAATCGATACCGCTGGTTTGTATTCG AAACGTCCTGGTTTACCAGATTCCCCAATTTTTGACAAAACCTCGAAATTACAACATCCA AATTGGGGGTCTCACAATGGTCCTAGGATTCATGAATATCATCAAGAACTACACAGATTT ATGAAAAACAGGGTGAAAGATGGTAGAGAAATAATGAGAGTCGGTGAAGTTGCCCATGGA AGTGATAATGCTTTATACACCAGTGCAGCTAGATACGAAGTCAGCGAAGTTTTCTCCTTC ACGCACGTTGAAGTTGGTACCTCGCCATTTTTCCGTTATAACATAGTGCCCTTCACCTTG AAACAATGGAAAGAAGCCATTGCATCGAACTTTTTGTTCATTAACGGTACTGATAGTTGG GCTACCACCTACATCGAGAATCACGATCAAGCCCGGTCAATTACGAGATTTGCTGACGAT TCGCCAAAGTACCGTAAAATATCTGGTAAGCTGTTAACATTGCTAGAATGTTCATTGACA GGTACGTTGTATGTCTATCAAGGTCAGGAGATAGGCCAGATCAATTTCAAGGAATGGCCT ATTGAAAAGTATGAGGACGTTGATGTGAAAAACAACTACGAGATTATCAAAAAAAGTTTT GGTAAAAACTCGAAGGAAATGAAGGATTTTTTTAAAGGAATCGCCCTACTTTCTAGAGAT CATTCGAGAACTCCCATGCCATGGACGAAAGATAAGCCCAATGCTGGATTTACTGGCCCA GATGTTAAACCTTGGTTTTTCTTGAATGAATCTTTCGAGCAAGGAATCAATGTTGAGCAG GAATCCAGAGATGATGACTCAGTTCTCAATTTTTGGAAAAGGGCCTTGCAAGCCAGAAAG AAATATAAGGAACTTATGATTTATGGTTACGATTTCCAATTCATTGATTTAGACAGTGAC CAGATCTTTAGCTTCACTAAAGAGTACGAAGACAAGACGCTGTTTGCTGCTTTAAATTTC AGTGGCGAAGAAATTGAATTCAGCCTCCCAAGAGAAGGTGCTTCTTTATCTTTTATTCTT GGAAATTATGATGATACTGACGTTTCCTCCAGAGTTTTGAAACCATGGGAAGGTAGAATC TACCTCGTCAAATAA
Protein Properties
Pfam Domain Function
Protein Residues584
Protein Molecular Weight68182.79688
Protein Theoretical pI5.56
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Alpha-glucosidase MAL62 MTISDHPETEPKWWKEATIYQIYPASFKDSNNDGWGDLKGITSKLQYIKDLGVDAIWVCP FYDSPQQDMGYDISNYEKVWPTYGTNEDCFELIDKTHKLGMKFITDLVINHCSTEHEWFK ESRSSKTNPKRDWFFWRPPKGYDAEGKPIPPNNWKSFFGGSAWTFDETTNEFYLRLFASR QVDLNWENEDCRRAIFESAVGFWLDHGVDGFRIDTAGLYSKRPGLPDSPIFDKTSKLQHP NWGSHNGPRIHEYHQELHRFMKNRVKDGREIMRVGEVAHGSDNALYTSAARYEVSEVFSF THVEVGTSPFFRYNIVPFTLKQWKEAIASNFLFINGTDSWATTYIENHDQARSITRFADD SPKYRKISGKLLTLLECSLTGTLYVYQGQEIGQINFKEWPIEKYEDVDVKNNYEIIKKSF GKNSKEMKDFFKGIALLSRDHSRTPMPWTKDKPNAGFTGPDVKPWFFLNESFEQGINVEQ ESRDDDSVLNFWKRALQARKKYKELMIYGYDFQFIDLDSDQIFSFTKEYEDKTLFAALNF SGEEIEFSLPREGASLSFILGNYDDTDVSSRVLKPWEGRIYLVK
References
External Links
ResourceLink
Saccharomyces Genome Database MAL62
Uniprot IDP07265
Uniprot NameMAL62_YEAST
GenBank Gene IDM12601
Genebank Protein ID171888
General Reference
  • Hong, S. H., Marmur, J. (1986). "Primary structure of the maltase gene of the MAL6 locus of Saccharomyces carlsbergensis." Gene 41:75-84.3516795