Canmetcon
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
Name3-isopropylmalate dehydratase
Synonyms
  • Alpha-IPM isomerase
  • IPMI
  • Isopropylmalate isomerase
Gene NameLEU1
Enzyme Class
Biological Properties
General FunctionInvolved in 3-isopropylmalate dehydratase activity
Specific FunctionCatalyzes the isomerization between 2-isopropylmalate and 3-isopropylmalate, via the formation of 2-isopropylmaleate
Cellular LocationNot Available
SMPDB Pathways
Citric Acid Cycle 1434561204PW000970 ThumbThumb?image type=greyscaleThumb?image type=simple
TCA CyclePW002377 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Valine, leucine and isoleucine biosynthesisec00290 Map00290
SMPDB ReactionsNot Available
KEGG Reactions
water + 2-Isopropylmaleic acid2-Isopropylmalic acid
3-Isopropylmalatewater + 2-Isopropylmaleic acid
Metabolites
YMDB IDNameView
YMDB001062-Isopropylmalic acidShow
YMDB003683-IsopropylmalateShow
YMDB004422-Isopropylmaleic acidShow
YMDB00890waterShow
GO Classification
Component
macromolecular complex
protein complex
3-isopropylmalate dehydratase complex
Function
lyase activity
binding
metal cluster binding
3-isopropylmalate dehydratase activity
iron-sulfur cluster binding
carbon-oxygen lyase activity
catalytic activity
hydro-lyase activity
4 iron, 4 sulfur cluster binding
Process
branched chain family amino acid metabolic process
cellular metabolic process
cellular amino acid and derivative metabolic process
cellular amino acid metabolic process
leucine metabolic process
leucine biosynthetic process
cellular amino acid biosynthetic process
metabolic process
Gene Properties
Chromosome Locationchromosome 7
LocusYGL009C
Gene Sequence>2340 bp ATGGTTTACACTCCATCCAAGGGTCCAAGAACTCTTTACGATAAGGTTTTTGATGCACAT GTTGTCCATCAAGATGAAAATGGTTCCTTTTTGTTGTATATCGACAGACACTTGGTTCAT GAAGTCACCTCTCCACAAGCTTTCGAAGGCCTAGAAAATGCCGGCAGAAAGGTCAGAAGA GTTGATTGTACTCTAGCTACTGTAGATCATAATATTCCAACTGAATCAAGAAAGAATTTC AAATCACTAGACACATTTATCAAGCAAACTGATTCGCGTTTACAAGTCAAAACTTTAGAG AATAATGTTAAACAGTTCGGCGTTCCATATTTCGGTATGAGTGATGCCAGACAAGGTATC GTCCACACCATCGGTCCCGAAGAAGGTTTCACTTTACCAGGTACCACTGTTGTTTGTGGT GACTCTCATACCTCTACTCACGGTGCCTTTGGTTCGCTGGCCTTTGGTATTGGTACTTCT GAAGTTGAACACGTCTTGGCCACTCAAACAATTATCCAAGCTAAATCGAAAAACATGAGA ATTACTGTTAATGGTAAGCTATCACCTGGTATCACATCTAAAGATTTGATTTTGTATATT ATTGGTCTGATAGGTACTGCAGGTGGTACTGGTTGCGTTATTGAATTCGCAGGTGAAGCC ATTGAAGCTCTTTCTATGGAAGCACGTATGTCCATGTGTAACATGGCCATCGAAGCTGGT GCAAGAGCAGGTATGATTAAACCAGACGAAACTACTTTCCAATACACCAAAGGCAGACCT TTGGCTCCAAAAGGTGCCGAATGGGAAAAGGCTGTTGCCTACTGGAAAACTTTGAAAACA GACGAAGGTGCCAAATTTGACCACGAAATCAACATTGAAGCTGTCGACGTGATTCCAACT ATTACATGGGGTACTTCTCCTCAAGATGCCTTACCAATTACTGGTTCCGTACCAGATCCA AAAAATGTTACAGACCCAATAAAGAAATCTGGTATGGAAAGAGCCTTAGCCTATATGGGT TTGGAACCTAACACACCGCTAAAGAGCATCAAAGTAGATAAAGTCTTTATTGGATCTTGT ACCAATGGCCGTATTGAAGATTTAAGAAGTGCTGCAGCTGTAGTTAGGGGTCAAAAATTG GCTAGTAACATCAAATTAGCTATGGTTGTTCCGGGATCTGGTTTGGTCAAAAAACAAGCC GAAGCAGAAGGTTTGGACAAGATTTTCCAAGAAGCTGGTTTTGAATGGAGAGAAGCTGGT TGTTCAATATGTTTAGGTATGAACCCTGATATTTTGGATGCCTATGAACGTTGTGCTTCT ACTTCCAACAGAAATTTCGAAGGTCGTCAAGGTGCCTTGTCTCGTACACATCTAATGTCC CCAGCCATGGCGGCTGCTGCAGGTATCGCAGGTCACTTCGTAGATATTAGAGAATTCGAA TATAAGGATCAAGACCAAAGTAGTCCAAAGGTTGAGGTCACTTCCGAAGATGAAAAAGAG CTTGAAAGTGCTGCTTACGATCACGCTGAACCTGTCCAACCCGAAGACGCTCCCCAAGAT ATTGCCAATGATGAATTAAAAGATATTCCAGTGAAGTCAGATGATACACCTGCTAAACCT AGCTCTTCCGGCATGAAGCCATTTTTGACTTTGGAAGGTATTAGCGCACCATTAGATAAG GCCAATGTTGATACAGACGCTATTATCCCAAAGCAATTTTTAAAGACAATTAAGAGAACG GGTTTGAAAAAAGGGTTGTTTTATGAATGGCGTTTCCGTAAAGACGATCAAGGTAAGGAT CAAGAAACCGATTTTGTATTAAATGTTGAACCTTGGAGGGAAGCTGAAATATTGGTTGTT ACTGGTGACAATTTCGGATGTGGTTCTTCCAGAGAACACGCACCATGGGCTCTAAAAGAC TTTGGTATAAAATCCATCATTGCACCTTCTTACGGTGATATTTTCTACAACAACTCTTTC AAGAACGGCTTATTACCTATTAGATTGGATCAACAAATAATCATTGACAAATTGATCCCT ATTGCTAATAAGGGTGGTAAGCTCTGCGTCGATTTACCAAATCAAAAAATTTTGGATTCC GATGGCAATGTGCTCGTTGATCATTTTGAAATAGAACCTTTCAGAAAGCACTGCCTAGTT AACGGTCTTGATGATATTGGTATTACATTGCAAAAGGAAGAATACATTTCCAGATACGAA GCTTTGAGAAGAGAGAAATACTCATTCTTGGAAGGTGGATCAAAATTATTAAAATTTGAC AACGTTCCAAAAAGAAAAGCTGTTACAACTACTTTCGATAAAGTCCACCAGGATTGGTAG
Protein Properties
Pfam Domain Function
Protein Residues779
Protein Molecular Weight85793.70313
Protein Theoretical pI5.69
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>3-isopropylmalate dehydratase MVYTPSKGPRTLYDKVFDAHVVHQDENGSFLLYIDRHLVHEVTSPQAFEGLENAGRKVRR VDCTLATVDHNIPTESRKNFKSLDTFIKQTDSRLQVKTLENNVKQFGVPYFGMSDARQGI VHTIGPEEGFTLPGTTVVCGDSHTSTHGAFGSLAFGIGTSEVEHVLATQTIIQAKSKNMR ITVNGKLSPGITSKDLILYIIGLIGTAGGTGCVIEFAGEAIEALSMEARMSMCNMAIEAG ARAGMIKPDETTFQYTKGRPLAPKGAEWEKAVAYWKTLKTDEGAKFDHEINIEAVDVIPT ITWGTSPQDALPITGSVPDPKNVTDPIKKSGMERALAYMGLEPNTPLKSIKVDKVFIGSC TNGRIEDLRSAAAVVRGQKLASNIKLAMVVPGSGLVKKQAEAEGLDKIFQEAGFEWREAG CSICLGMNPDILDAYERCASTSNRNFEGRQGALSRTHLMSPAMAAAAGIAGHFVDIREFE YKDQDQSSPKVEVTSEDEKELESAAYDHAEPVQPEDAPQDIANDELKDIPVKSDDTPAKP SSSGMKPFLTLEGISAPLDKANVDTDAIIPKQFLKTIKRTGLKKGLFYEWRFRKDDQGKD QETDFVLNVEPWREAEILVVTGDNFGCGSSREHAPWALKDFGIKSIIAPSYGDIFYNNSF KNGLLPIRLDQQIIIDKLIPIANKGGKLCVDLPNQKILDSDGNVLVDHFEIEPFRKHCLV NGLDDIGITLQKEEYISRYEALRREKYSFLEGGSKLLKFDNVPKRKAVTTTFDKVHQDW
References
External Links
ResourceLink
Saccharomyces Genome Database LEU1
Uniprot IDP07264
Uniprot NameLEUC_YEAST
GenBank Gene IDZ72531
Genebank Protein ID1322463
General Reference
  • Skala, J., Capieaux, E., Balzi, E., Chen, W. N., Goffeau, A. (1991). "Complete sequence of the Saccharomyces cerevisiae LEU1 gene encoding isopropylmalate isomerase." Yeast 7:281-285.1840714
  • Tettelin, H., Agostoni Carbone, M. L., Albermann, K., Albers, M., Arroyo, J., Backes, U., Barreiros, T., Bertani, I., Bjourson, A. J., Bruckner, M., Bruschi, C. V., Carignani, G., Castagnoli, L., Cerdan, E., Clemente, M. L., Coblenz, A., Coglievina, M., Coissac, E., Defoor, E., Del Bino, S., Delius, H., Delneri, D., de Wergifosse, P., Dujon, B., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome VII." Nature 387:81-84.9169869
  • Hsu, Y. P., Schimmel, P. (1984). "Yeast LEU1. Repression of mRNA levels by leucine and relationship of 5'-noncoding region to that of LEU2." J Biol Chem 259:3714-3719.6323436
  • Chen, W. N., Balzi, E., Capieaux, E., Choder, M., Goffeau, A. (1991). "The DNA sequencing of the 17 kb HindIII fragment spanning the LEU1 and ATE1 loci on chromosome VII from Saccharomyces cerevisiae reveals the PDR6 gene, a new member of the genetic network controlling pleiotropic drug resistance." Yeast 7:287-299.1882553
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Gruhler, A., Olsen, J. V., Mohammed, S., Mortensen, P., Faergeman, N. J., Mann, M., Jensen, O. N. (2005). "Quantitative phosphoproteomics applied to the yeast pheromone signaling pathway." Mol Cell Proteomics 4:310-327.15665377
  • Li, X., Gerber, S. A., Rudner, A. D., Beausoleil, S. A., Haas, W., Villen, J., Elias, J. E., Gygi, S. P. (2007). "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae." J Proteome Res 6:1190-1197.17330950
  • Chi, A., Huttenhower, C., Geer, L. Y., Coon, J. J., Syka, J. E., Bai, D. L., Shabanowitz, J., Burke, D. J., Troyanskaya, O. G., Hunt, D. F. (2007). "Analysis of phosphorylation sites on proteins from Saccharomyces cerevisiae by electron transfer dissociation (ETD) mass spectrometry." Proc Natl Acad Sci U S A 104:2193-2198.17287358
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956