You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameHistidyl-tRNA synthetase, mitochondrial
Synonyms
  • Histidine--tRNA ligase
  • HisRS
Gene NameHTS1
Enzyme Class
Biological Properties
General FunctionInvolved in nucleotide binding
Specific FunctionATP + L-histidine + tRNA(His) = AMP + diphosphate + L-histidyl-tRNA(His)
Cellular LocationMitochondrion. Cytoplasm
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG Reactions
Adenosine triphosphate + L-Histidine + tRNA(His) → Adenosine monophosphate + Pyrophosphate + His-tRNA(His)
Metabolites
YMDB IDNameView
YMDB00097Adenosine monophosphateShow
YMDB00109Adenosine triphosphateShow
YMDB00219PyrophosphateShow
YMDB00369L-HistidineShow
GO Classification
Component
cytoplasm
cell part
intracellular part
Function
nucleoside binding
purine nucleoside binding
histidine-tRNA ligase activity
adenyl nucleotide binding
adenyl ribonucleotide binding
ATP binding
ligase activity, forming carbon-oxygen bonds
ligase activity, forming aminoacyl-tRNA and related compounds
catalytic activity
aminoacyl-tRNA ligase activity
nucleotide binding
ligase activity
binding
Process
macromolecule biosynthetic process
cellular macromolecule biosynthetic process
translation
histidyl-tRNA aminoacylation
metabolic process
macromolecule metabolic process
cellular macromolecule metabolic process
RNA metabolic process
ncRNA metabolic process
biosynthetic process
tRNA metabolic process
tRNA aminoacylation
tRNA aminoacylation for protein translation
Gene Properties
Chromosome Locationchromosome 16
LocusYPR033C
Gene Sequence>1641 bp ATGCTTAGTAGATCACTAAATAAAGTAGTCACATCTATAAAGTCGTCTTCGATAATCAGG ATGTCATCCGCTACCGCTGCTGCTACTTCTGCTCCTACTGCTAATGCTGCTAATGCTCTA AAAGCTTCAAAGGCTCCAAAGAAAGGTAAACTACAAGTGTCTTTGAAAACACCTAAGGGT ACGAAGGATTGGGCTGATAGTGATATGGTTATCAGAGAAGCCATTTTTAGCACTTTATCT GGCCTATTCAAGAAGCATGGTGGTGTCACTATCGACACACCTGTTTTCGAGTTAAGAGAA ATTTTAGCAGGCAAGTATGGTGAGGACTCCAAACTGATCTACAACTTGGAGGACCAGGGT GGTGAATTATGTTCTTTACGTTACGATTTGACCGTTCCTTTTGCCAGGTACGTTGCCATG AACAATATTCAGAGTATCAAGAGGTATCACATTGCAAAAGTCTACAGAAGAGACCAACCA GCCATGACTAAGGGTCGTATGAGAGAATTTTACCAGTGTGATTTTGACGTTGCAGGCACA TTCGAATCTATGGTTCCTGATTCCGAATGTTTGTCCATTTTAGTGGAAGGTTTGACCAGT TTGGGAATCAAAGATTTCAAAATCAAATTGAATCACAGGAAGATTCTTGATGGGATCTTC CAAATCGCTGGTGTTAAAGATGAGGATGTGAGGAAAATCTCTTCTGCTGTCGATAAGTTG GACAAATCTCCATGGGAAGCAGTCAAGAAGGAAATGACCGAAGAAAAAGGTCAATCCGAA GAAACTGCTGATAAAATCGGTGAGTATGTTAAATTAAATGGTTCTTTGAAGGAAATTCAC GCTGTTCTATCCGCAGATGCCAACATTACTTCAAACGAAAAGGCTAAACAAGGTTTGGAT GATATTGCTACTTTGATGAAGTATACCGAAGCATTTGACATTGACTCATTCATCTCTTTT GATCTTTCTCTTGCAAGAGGTTTGGATTACTATACAGGTTTGATCTATGAAGTTGTTACT TCTGCATCTGCTCCACCAGAGAATGCTTCAGAATTGAAGAAGAAGGCCAAATCTGCAGAA GACGCGTCAGAATTCGTTGGTGTCGGCTCTATTGCAGCCGGTGGTCGATATGATAATTTG GTCAACATGTTCTCTGAAGCTTCCGGCAAAAAATCTACTCAAATTCCATGTGTTGGTATT TCATTTGGTGTTGAAAGAATATTTTCTTTGATCAAACAAAGAATTAATTCCTCTACAACT ATAAAGCCAACGGCTACACAGGTGTTCGTTATGGCTTTTGGTGGTGGTAAGGACTGGACT GGTTATTTACCCGAAAGAATGAAGGTTACTAAGCAATTATGGGATGCTGGCATTGAAGCT GAATATGTCTATAAGGCCAAGGCTAATCCTAGGAAGCAATTCGATGCTGCTGAAAAAGCG GGTTGTCACATTGCCGTAATCCTCGGTAAGGAGGAGTACTTAGAAGGTAAATTACGTGTC AAAAGATTGGGCCAAGAATTTGCCGATGATGATGGTGAATTGGTTAGTGCGGCTGACATT GTTCCTATTGTTCAAGAAAAGTTATCACAAATTCATGAAGATGGTCTAAATGAGGTCACT CGTTTAATTAAAGGATTATAA
Protein Properties
Pfam Domain Function
Protein Residues546
Protein Molecular Weight59952.0
Protein Theoretical pI7.87
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Histidyl-tRNA synthetase, mitochondrial MLSRSLNKVVTSIKSSSIIRMSSATAAATSAPTANAANALKASKAPKKGKLQVSLKTPKG TKDWADSDMVIREAIFSTLSGLFKKHGGVTIDTPVFELREILAGKYGEDSKLIYNLEDQG GELCSLRYDLTVPFARYVAMNNIQSIKRYHIAKVYRRDQPAMTKGRMREFYQCDFDVAGT FESMVPDSECLSILVEGLTSLGIKDFKIKLNHRKILDGIFQIAGVKDEDVRKISSAVDKL DKSPWEAVKKEMTEEKGQSEETADKIGEYVKLNGSLKEIHAVLSADANITSNEKAKQGLD DIATLMKYTEAFDIDSFISFDLSLARGLDYYTGLIYEVVTSASAPPENASELKKKAKSAE DASEFVGVGSIAAGGRYDNLVNMFSEASGKKSTQIPCVGISFGVERIFSLIKQRINSSTT IKPTATQVFVMAFGGGKDWTGYLPERMKVTKQLWDAGIEAEYVYKAKANPRKQFDAAEKA GCHIAVILGKEEYLEGKLRVKRLGQEFADDDGELVSAADIVPIVQEKLSQIHEDGLNEVT RLIKGL
References
External Links
ResourceLink
Saccharomyces Genome Database HTS1
Uniprot IDP07263
Uniprot NameSYH_YEAST
GenBank Gene IDAY692751
Genebank Protein ID51012953
General Reference
  • Natsoulis, G., Hilger, F., Fink, G. R. (1986). "The HTS1 gene encodes both the cytoplasmic and mitochondrial histidine tRNA synthetases of S. cerevisiae." Cell 46:235-243.3521891
  • Bussey, H., Storms, R. K., Ahmed, A., Albermann, K., Allen, E., Ansorge, W., Araujo, R., Aparicio, A., Barrell, B., Badcock, K., Benes, V., Botstein, D., Bowman, S., Bruckner, M., Carpenter, J., Cherry, J. M., Chung, E., Churcher, C., Coster, F., Davis, K., Davis, R. W., Dietrich, F. S., Delius, H., DiPaolo, T., Hani, J., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XVI." Nature 387:103-105.9169875
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Chiu, M. I., Mason, T. L., Fink, G. R. (1992). "HTS1 encodes both the cytoplasmic and mitochondrial histidyl-tRNA synthetase of Saccharomyces cerevisiae: mutations alter the specificity of compartmentation." Genetics 132:987-1001.1459448
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106