You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameCytochrome b-c1 complex subunit 2, mitochondrial
Synonyms
  • Complex III subunit 2
  • Core protein II
  • Ubiquinol-cytochrome-c reductase complex core protein 2
Gene NameQCR2
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in metalloendopeptidase activity
Specific FunctionComponent of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain that generates an electrochemical potential coupled to ATP synthesis. The complex couples electron transfer from ubiquinol to cytochrome c. QCR2 is required for the assembly of the complex
Cellular LocationMitochondrion inner membrane
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
GO Classification
Function
peptidase activity, acting on L-amino acid peptides
endopeptidase activity
metalloendopeptidase activity
binding
ion binding
cation binding
metal ion binding
transition metal ion binding
zinc ion binding
catalytic activity
hydrolase activity
peptidase activity
Process
proteolysis
metabolic process
macromolecule metabolic process
protein metabolic process
Gene Properties
Chromosome LocationNot Available
Locus
Gene Sequence>1107 bp ATGTTGTCAGCAGCTAGATTGCAATTTGCCCAGGGGTCAGTTAGAAGGTTGACCGTTTCC GCTAGAGACGCACCTACTAAAATATCTACATTGGCTGTTAAGGTCCATGGAGGGTCTCGT TATGCAACCAAGGATGGTGTGGCCCATCTTTTAAACAGATTCAACTTTCAAAACACGAAC ACTAGATCAGCTTTGAAATTAGTCAGAGAATCCGAATTATTAGGGGGAACTTTTAAGTCT ACCTTGGATAGGGAATACATCACTTTGAAAGCTACCTTTTTGAAGGACGACCTTCCCTAC TACGTCAATGCCCTAGCAGACGTGCTATACAAGACTGCCTTCAAACCTCACGAGCTCACC GAATCTGTTTTGCCTGCTGCTAGATACGATTATGCGGTCGCTGAACAATGTCCGGTAAAG AGCGCCGAAGACCAATTGTATGCCATTACATTCAGAAAGGGTTTAGGAAACCCATTGTTA TACGATGGTGTGGAAAGAGTCAGTTTGCAAGATATCAAGGACTTTGCGGACAAAGTCTAT ACCAAGGAGAACCTTGAAGTTAGCGGTGAAAATGTTGTTGAGGCCGATTTGAAAAGATTT GTTGACGAGTCACTGTTAAGCACTTTGCCTGCAGGTAAGTCATTGGTGAGTAAATCCGAA CCAAAATTCTTTTTGGGTGAAGAAAACAGGGTAAGGTTTATCGGTGACTCCGTTGCCGCC ATTGGTATCCCGGTAAACAAAGCCTCCCTAGCTCAATATGAAGTATTGGCCAACTATTTG ACCTCTGCCCTATCCGAGCTTTCCGGTTTAATCAGCTCGGCTAAACTTGATAAATTCACT GACGGCGGCCTATTTACTCTGTTTGTAAGAGACCAGGACAGCGCCGTGGTATCTTCCAAC ATCAAGAAAATTGTTGCGGATTTGAAGAAGGGCAAGGACTTATCCCCTGCAATAAATTAC ACAAAGTTAAAGAATGCCGTCCAAAATGAATCTGTTTCCAGCCCAATTGAACTAAATTTT GACGCCGTGAAGGACTTTAAGTTGGGAAAATTCAACTATGTAGCCGTCGGTGATGTTTCC AACTTGCCATATTTGGACGAATTGTAA
Protein Properties
Pfam Domain Function
Protein Residues368
Protein Molecular Weight40477.69922
Protein Theoretical pI8.3
PDB Fileshow
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Cytochrome b-c1 complex subunit 2, mitochondrial MLSAARLQFAQGSVRRLTVSARDAPTKISTLAVKVHGGSRYATKDGVAHLLNRFNFQNTN TRSALKLVRESELLGGTFKSTLDREYITLKATFLKDDLPYYVNALADVLYKTAFKPHELT ESVLPAARYDYAVAEQCPVKSAEDQLYAITFRKGLGNPLLYDGVERVSLQDIKDFADKVY TKENLEVSGENVVEADLKRFVDESLLSTLPAGKSLVSKSEPKFFLGEENRVRFIGDSVAA IGIPVNKASLAQYEVLANYLTSALSELSGLISSAKLDKFTDGGLFTLFVRDQDSAVVSSN IKKIVADLKKGKDLSPAINYTKLKNAVQNESVSSPIELNFDAVKDFKLGKFNYVAVGDVS NLPYLDEL
References
External Links
ResourceLink
Saccharomyces Genome Database QCR2
Uniprot IDP07257
Uniprot NameQCR2_YEAST
GenBank Gene IDAY558068
Genebank Protein ID45270026
PDB ID
1P84
General Reference
  • Oudshoorn, P., Van Steeg, H., Swinkels, B. W., Schoppink, P., Grivell, L. A. (1987). "Subunit II of yeast QH2:cytochrome-c oxidoreductase. Nucleotide sequence of the gene and features of the protein." Eur J Biochem 163:97-103.3028797
  • Bussey, H., Storms, R. K., Ahmed, A., Albermann, K., Allen, E., Ansorge, W., Araujo, R., Aparicio, A., Barrell, B., Badcock, K., Benes, V., Botstein, D., Bowman, S., Bruckner, M., Carpenter, J., Cherry, J. M., Chung, E., Churcher, C., Coster, F., Davis, K., Davis, R. W., Dietrich, F. S., Delius, H., DiPaolo, T., Hani, J., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XVI." Nature 387:103-105.9169875
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Grandier-Vazeille, X., Bathany, K., Chaignepain, S., Camougrand, N., Manon, S., Schmitter, J. M. (2001). "Yeast mitochondrial dehydrogenases are associated in a supramolecular complex." Biochemistry 40:9758-9769.11502169
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Reinders, J., Wagner, K., Zahedi, R. P., Stojanovski, D., Eyrich, B., van der Laan, M., Rehling, P., Sickmann, A., Pfanner, N., Meisinger, C. (2007). "Profiling phosphoproteins of yeast mitochondria reveals a role of phosphorylation in assembly of the ATP synthase." Mol Cell Proteomics 6:1896-1906.17761666
  • Hunte, C., Koepke, J., Lange, C., Rossmanith, T., Michel, H. (2000). "Structure at 2.3 A resolution of the cytochrome bc(1) complex from the yeast Saccharomyces cerevisiae co-crystallized with an antibody Fv fragment." Structure 8:669-684.10873857
  • Lange, C., Hunte, C. (2002). "Crystal structure of the yeast cytochrome bc1 complex with its bound substrate cytochrome c." Proc Natl Acad Sci U S A 99:2800-2805.11880631