You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameCytochrome b-c1 complex subunit 1, mitochondrial
Synonyms
  • Complex III subunit 1
  • Core protein I
  • Ubiquinol-cytochrome-c reductase complex core protein 1
Gene NameCOR1
Enzyme ClassNot Available
Biological Properties
General FunctionInvolved in metalloendopeptidase activity
Specific FunctionComponent of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex), which is part of the mitochondrial respiratory chain that generates an electrochemical potential coupled to ATP synthesis. The complex couples electron transfer from ubiquinol to cytochrome c. COR1 may mediate formation of the complex between cytochromes c and c1
Cellular LocationMitochondrion inner membrane
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG ReactionsNot Available
Metabolites
YMDB IDNameView
GO Classification
Function
hydrolase activity
peptidase activity
peptidase activity, acting on L-amino acid peptides
endopeptidase activity
metalloendopeptidase activity
binding
ion binding
cation binding
metal ion binding
transition metal ion binding
zinc ion binding
catalytic activity
Process
macromolecule metabolic process
protein metabolic process
proteolysis
metabolic process
Gene Properties
Chromosome LocationNot Available
Locus
Gene Sequence>1374 bp ATGCTAAGAACAGTAACTTCAAAGACTGTATCTAACCAGTTCAAGAGGTCTTTGGCTACA GCTGTAGCAACCCCCAAGGCCGAAGTAACGCAATTATCTAACGGTATAGTTGTAGCCACT GAGCATAATCCTTCCGCTCACACAGCCTCTGTCGGTGTTGTCTTCGGCTCCGGTGCTGCC AACGAAAACCCTTATAACAACGGGGTTTCCAATTTATGGAAGAACATCTTTCTATCCAAA GAAAACTCTGCTGTTGCCGCCAAGGAAGGTTTGGCATTGTCTTCCAATATCTCCAGAGAC TTCCAATCTTACATTGTATCTTCTTTGCCAGGTTCTACCGATAAATCACTAGACTTCTTG AATCAGTCTTTCATCCAACAAAAGGCTAATTTGCTATCTTCTTCTAACTTCGAGGCCACG AAGAAATCTGTCTTGAAGCAAGTTCAAGATTTTGAAGAAAACGACCATCCCAACAGAGTT TTGGAACATTTACACTCCACCGCCTTCCAAAACACTCCATTATCTTTGCCTACTAGAGGT ACTTTGGAGTCCTTGGAGAATTTAGTTGTTGCTGATCTGGAATCTTTTGCCAATAACCAT TTCTTGAATTCAAATGCTGTTGTTGTTGGTACCGGTAATATCAAACATGAGGATTTAGTA AATTCCATCGAATCCAAAAACCTAAGTTTGCAAACCGGTACCAAGCCCGTACTCAAGAAA AAGGCCGCTTTCTTGGGTTCCGAAGTTAGATTGAGAGACGACACCTTGCCAAAGGCGTGG ATTTCGCTGGCTGTGGAAGGTGAACCTGTCAATTCACCAAATTATTTTGTTGCTAAATTA GCCGCCCAAATTTTCGGCTCATACAACGCCTTCGAACCCGCTTCTAGATTACAAGGTATC AAATTGTTAGACAACATACAGGAGTACCAATTATGCGACAATTTCAATCATTTCTCTCTT TCTTACAAAGATTCCGGTTTATGGGGGTTCTCTACGGCCACGAGAAACGTTACCATGATT GACGACCTCATCCATTTCACTTTGAAACAATGGAACAGATTGACCATTTCTGTCACTGAT ACTGAAGTTGAACGTGCCAAATCGCTGTTGAAATTACAATTAGGGCAGTTATACGAATCT GGTAATCCCGTCAATGACGCTAACTTGTTAGGCGCAGAAGTCCTAATCAAGGGCTCCAAA CTGTCTCTGGGTGAGGCTTTCAAGAAAATTGATGCAATCACAGTCAAAGATGTTAAGGCT TGGGCCGGTAAGAGATTATGGGACCAAGATATTGCTATTGCTGGTACAGGCCAAATTGAA GGGTTATTAGATTACATGAGAATCAGAAGTGACATGTCCATGATGAGATGGTAA
Protein Properties
Pfam Domain Function
Protein Residues457
Protein Molecular Weight50227.39844
Protein Theoretical pI7.35
PDB Fileshow
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Cytochrome b-c1 complex subunit 1, mitochondrial MLRTVTSKTVSNQFKRSLATAVATPKAEVTQLSNGIVVATEHNPSAHTASVGVVFGSGAA NENPYNNGVSNLWKNIFLSKENSAVAAKEGLALSSNISRDFQSYIVSSLPGSTDKSLDFL NQSFIQQKANLLSSSNFEATKKSVLKQVQDFEENDHPNRVLEHLHSTAFQNTPLSLPTRG TLESLENLVVADLESFANNHFLNSNAVVVGTGNIKHEDLVNSIESKNLSLQTGTKPVLKK KAAFLGSEVRLRDDTLPKAWISLAVEGEPVNSPNYFVAKLAAQIFGSYNAFEPASRLQGI KLLDNIQEYQLCDNFNHFSLSYKDSGLWGFSTATRNVTMIDDLIHFTLKQWNRLTISVTD TEVERAKSLLKLQLGQLYESGNPVNDANLLGAEVLIKGSKLSLGEAFKKIDAITVKDVKA WAGKRLWDQDIAIAGTGQIEGLLDYMRIRSDMSMMRW
References
External Links
ResourceLink
Saccharomyces Genome Database COR1
Uniprot IDP07256
Uniprot NameQCR1_YEAST
GenBank Gene IDAY693047
Genebank Protein ID51013545
PDB ID
1P84
General Reference
  • Tzagoloff, A., Wu, M. A., Crivellone, M. (1986). "Assembly of the mitochondrial membrane system. Characterization of COR1, the structural gene for the 44-kilodalton core protein of yeast coenzyme QH2-cytochrome c reductase." J Biol Chem 261:17163-17169.3023384
  • De Wergifosse, P., Jacques, B., Jonniaux, J. L., Purnelle, B., Skala, J., Goffeau, A. (1994). "The sequence of a 22.4 kb DNA fragment from the left arm of yeast chromosome II reveals homologues to bacterial proline synthetase and murine alpha-adaptin, as well as a new permease and a DNA-binding protein." Yeast 10:1489-1496.7871888
  • Feldmann, H., Aigle, M., Aljinovic, G., Andre, B., Baclet, M. C., Barthe, C., Baur, A., Becam, A. M., Biteau, N., Boles, E., Brandt, T., Brendel, M., Bruckner, M., Bussereau, F., Christiansen, C., Contreras, R., Crouzet, M., Cziepluch, C., Demolis, N., Delaveau, T., Doignon, F., Domdey, H., Dusterhus, S., Dubois, E., Dujon, B., El Bakkoury, M., Entian, K. D., Feurmann, M., Fiers, W., Fobo, G. M., Fritz, C., Gassenhuber, H., Glandsdorff, N., Goffeau, A., Grivell, L. A., de Haan, M., Hein, C., Herbert, C. J., Hollenberg, C. P., Holmstrom, K., Jacq, C., Jacquet, M., Jauniaux, J. C., Jonniaux, J. L., Kallesoe, T., Kiesau, P., Kirchrath, L., Kotter, P., Korol, S., Liebl, S., Logghe, M., Lohan, A. J., Louis, E. J., Li, Z. Y., Maat, M. J., Mallet, L., Mannhaupt, G., Messenguy, F., Miosga, T., Molemans, F., Muller, S., Nasr, F., Obermaier, B., Perea, J., Pierard, A., Piravandi, E., Pohl, F. M., Pohl, T. M., Potier, S., Proft, M., Purnelle, B., Ramezani Rad, M., Rieger, M., Rose, M., Schaaff-Gerstenschlager, I., Scherens, B., Schwarzlose, C., Skala, J., Slonimski, P. P., Smits, P. H., Souciet, J. L., Steensma, H. Y., Stucka, R., Urrestarazu, A., van der Aart, Q. J., van Dyck, L., Vassarotti, A., Vetter, I., Vierendeels, F., Vissers, S., Wagner, G., de Wergifosse, P., Wolfe, K. H., Zagulski, M., Zimmermann, F. K., Mewes, H. W., Kleine, K. (1994). "Complete DNA sequence of yeast chromosome II." EMBO J 13:5795-5809.7813418
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Grandier-Vazeille, X., Bathany, K., Chaignepain, S., Camougrand, N., Manon, S., Schmitter, J. M. (2001). "Yeast mitochondrial dehydrogenases are associated in a supramolecular complex." Biochemistry 40:9758-9769.11502169
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956
  • Hunte, C., Koepke, J., Lange, C., Rossmanith, T., Michel, H. (2000). "Structure at 2.3 A resolution of the cytochrome bc(1) complex from the yeast Saccharomyces cerevisiae co-crystallized with an antibody Fv fragment." Structure 8:669-684.10873857
  • Lange, C., Hunte, C. (2002). "Crystal structure of the yeast cytochrome bc1 complex with its bound substrate cytochrome c." Proc Natl Acad Sci U S A 99:2800-2805.11880631