You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameInositol polyphosphate multikinase
Synonyms
  • IPMK
  • Arginine metabolism regulation protein III
Gene NameARG82
Enzyme Class
Biological Properties
General FunctionInvolved in inositol trisphosphate 3-kinase activity
Specific FunctionHas kinase activity and phosphorylates inositol-1,4,5- trisphosphate (Ins(1,4,5)P3) and inositol-1,3,4,5- tetrakisphosphate (Ins(1,3,4,5)P4). Has low kinase activity towards InsP6. Originally it was proposed that the ARGRI and ARGRIII proteins are more likely to be involved in the control of ARGRII activity
Cellular LocationNot Available
SMPDB Pathways
Inositol phosphate metabolismPW002495 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Inositol phosphate metabolismec00562 Map00562
SMPDB Reactions
Myo-Inositol hexakisphosphate + Adenosine triphosphate5-Diphosphoinositol pentakisphosphate + ADP
Myo-Inositol hexakisphosphate + Adenosine triphosphate + hydron1-Diphosinositol pentakisphosphate + ADP
Myo-Inositol hexakisphosphate + Adenosine triphosphate + hydron5-Diphosphoinositol pentakisphosphate + ADP
Myo-Inositol hexakisphosphate + Adenosine triphosphate + hydron3-diphospho-1D-myo-inositol 1,2,4,5,6-pentakisphosphate + ADP
1-Diphosinositol pentakisphosphate + Adenosine triphosphate1D-myo-inositol 1,5-bis(diphosphate) 2,3,4,6-tetrakisphosphate + ADP
KEGG Reactions
Adenosine triphosphate + hydron + 1D-Myo-Inositol 1,3,4,5-tetrakisphosphateADP + Inositol 1,3,4,5,6-pentakisphosphate
Adenosine triphosphate + hydron + 1D-Myo-inositol 1,4,5,6-tetrakisphosphateADP + Inositol 1,3,4,5,6-pentakisphosphate
Adenosine triphosphate + hydron + Inositol 1,4,5-trisphosphate1D-Myo-inositol 1,4,5,6-tetrakisphosphate + ADP
Adenosine triphosphate + hydron + Inositol 1,4,5-trisphosphate1D-Myo-Inositol 1,3,4,5-tetrakisphosphate + ADP
Metabolites
YMDB IDNameView
YMDB000061D-Myo-inositol 1,4,5,6-tetrakisphosphateShow
YMDB000135-Diphosphoinositol pentakisphosphateShow
YMDB00109Adenosine triphosphateShow
YMDB00291Inositol 1,4,5-trisphosphateShow
YMDB00500Myo-Inositol hexakisphosphateShow
YMDB007111D-Myo-Inositol 1,3,4,5-tetrakisphosphateShow
YMDB007641D-myo-inositol 4,5-bisphosphateShow
YMDB00862hydronShow
YMDB00914ADPShow
YMDB00946Inositol 1,3,4,5,6-pentakisphosphateShow
YMDB162411-Diphosinositol pentakisphosphateShow
YMDB163333-diphospho-1D-myo-inositol 1,2,4,5,6-pentakisphosphate Show
YMDB163341D-myo-inositol 1,5-bis(diphosphate) 2,3,4,6-tetrakisphosphateShow
YMDB163353,5-bisdiphosphoinositol-1D-myo-inositol 2,3,4,6-tetrakisphosphateShow
GO Classification
Component
Not Available
Function
kinase activity
inositol or phosphatidylinositol kinase activity
inositol trisphosphate kinase activity
inositol trisphosphate 3-kinase activity
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
Process
Not Available
Gene Properties
Chromosome Locationchromosome 4
LocusYDR173C
Gene Sequence>1068 bp ATGGATACGGTAAACAATTATAGGGTTTTAGAGCATAAAGCTGCTGGCCACGACGGTACT CTAACAGACGGTGATGGATTGCTCATCTTTAAACCGGCCTTTCCGCAGGAACTGGAATTC TACAAAGCCATACAAGTGAGAGATGTGAGTCGAAGAAAGTCTTCGGCTGATGGAGATGCT CCCTTGTGCTCTTGGATGCCCACGTATCTTGGAGTCTTGAATGAAGGGGCAAAAATCGAG CAAAGTGGCGATGCTGCGCTTCTGAAGATAGATGAGCGGTTAAGTGATTCCACTGATAAT CTTGATTCAATACCTGTAAAGTCTGAGAAGTCCAAGCAATACCTCGTTTTAGAAAATCTA CTATATGGATTTAGTAAACCTAATATACTTGATATAAAATTAGGCAAAACTTTGTATGAT TCGAAGGCATCATTGGAAAAAAGAGAGAGAATGAAAAGAGTCAGTGAGACGACGACTTCA GGATCTTTGGGTTTCAGGATATGTGGCATGAAAATACAGAAAAATCCCTCTGTGCTGAAT CAGCTTTCGCTCGAATATTACGAAGAAGAAGCAGACAGTGATTATATCTTTATAAACAAA TTGTATGGTCGTTCAAGAACCGATCAAAATGTTTCAGATGCAATTGAACTTTATTTTAAC AATCCTCATCTGTCGGATGCGAGAAAGCATCAACTGAAGAAAACATTTTTGAAAAGATTG CAGTTGTTTTATAATACTATGCTAGAAGAAGAAGTTAGAATGATATCAAGTAGTCTTTTG TTTATTTACGAAGGAGACCCGGAGCGATGGGAATTACTAAATGATGTTGACAAACTTATG CGAGATGATTTTATAGACGATGATGACGACGATGATGATAATGATGATGATGATGATGAT GATGCCGAGGGAAGCAGCGAAGGACCAAAGGACAAAAAAACAACTGGTTCTTTGAGTTCC ATGTCACTAATAGATTTTGCACATTCTGAAATAACGCCGGGGAAGGGTTATGATGAAAAC GTGATTGAAGGAGTTGAAACCTTGCTAGATATTTTTATGAAATTCTAG
Protein Properties
Pfam Domain Function
Protein Residues355
Protein Molecular Weight40352.5
Protein Theoretical pI4.33
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Inositol polyphosphate multikinase MDTVNNYRVLEHKAAGHDGTLTDGDGLLIFKPAFPQELEFYKAIQVRDVSRRKSSADGDA PLCSWMPTYLGVLNEGAKIEQSGDAALLKIDERLSDSTDNLDSIPVKSEKSKQYLVLENL LYGFSKPNILDIKLGKTLYDSKASLEKRERMKRVSETTTSGSLGFRICGMKIQKNPSVLN QLSLEYYEEEADSDYIFINKLYGRSRTDQNVSDAIELYFNNPHLSDARKHQLKKTFLKRL QLFYNTMLEEEVRMISSSLLFIYEGDPERWELLNDVDKLMRDDFIDDDDDDDDNDDDDDD DAEGSSEGPKDKKTTGSLSSMSLIDFAHSEITPGKGYDENVIEGVETLLDIFMKF
References
External Links
ResourceLink
Saccharomyces Genome Database ARG82
Uniprot IDP07250
Uniprot NameIPMK_YEAST
GenBank Gene IDX05328
Genebank Protein ID3376
General Reference
  • Dubois, E., Bercy, J., Messenguy, F. (1987). "Characterization of two genes, ARGRI and ARGRIII required for specific regulation of arginine metabolism in yeast." Mol Gen Genet 207:142-148.3298999
  • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867
  • Saiardi, A., Erdjument-Bromage, H., Snowman, A. M., Tempst, P., Snyder, S. H. (1999). "Synthesis of diphosphoinositol pentakisphosphate by a newly identified family of higher inositol polyphosphate kinases." Curr Biol 9:1323-1326.10574768
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956