You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameBifunctional purine biosynthetic protein ADE5,7
Synonyms
  • Phosphoribosylamine--glycine ligase
  • Glycinamide ribonucleotide synthetase
  • GARS
  • Phosphoribosylglycinamide synthetase
  • Phosphoribosylformylglycinamidine cyclo-ligase
  • AIR synthase
  • AIRS
  • Phosphoribosyl-aminoimidazole synthetase
Gene NameADE5
Enzyme Class
Biological Properties
General FunctionInvolved in catalytic activity
Specific FunctionATP + 5-phospho-D-ribosylamine + glycine = ADP + phosphate + N(1)-(5-phospho-D-ribosyl)glycinamide
Cellular LocationNot Available
SMPDB PathwaysNot Available
KEGG Pathways
Purine metabolismec00230 Map00230
SMPDB ReactionsNot Available
KEGG Reactions
Adenosine triphosphate + 2-(Formamido)-N1-(5-phospho-D-ribosyl)acetamidine5-Aminoimidazole ribonucleotide + phosphate + hydron + ADP
Adenosine triphosphate + Glycine + 5-Phosphoribosylaminephosphate + hydron + ADP + Glycineamideribotide
Metabolites
YMDB IDNameView
YMDB00016GlycineShow
YMDB000655-Aminoimidazole ribonucleotideShow
YMDB000675-PhosphoribosylamineShow
YMDB00109Adenosine triphosphateShow
YMDB00374GlycineamideribotideShow
YMDB003982-(Formamido)-N1-(5-phospho-D-ribosyl)acetamidineShow
YMDB004925-Amino-1-(5-phospho-D-ribosyl)imidazoleShow
YMDB007582-formamido-N(1)-(5-phospho-D-ribosyl)acetamidineShow
YMDB00760N(1)-(5-phospho-D-ribosyl)glycinamideShow
YMDB00862hydronShow
YMDB00907phosphateShow
YMDB00914ADPShow
GO Classification
Component
intracellular part
cytoplasm
cell part
Function
cyclo-ligase activity
phosphoribosylformylglycinamidine cyclo-ligase activity
nucleoside binding
phosphoribosylamine-glycine ligase activity
catalytic activity
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
ligase activity
ATP binding
ligase activity, forming carbon-nitrogen bonds
binding
Process
nucleobase, nucleoside and nucleotide metabolic process
nucleoside phosphate metabolic process
nucleotide metabolic process
purine nucleotide metabolic process
metabolic process
purine nucleotide biosynthetic process
purine nucleoside monophosphate biosynthetic process
purine ribonucleoside monophosphate biosynthetic process
IMP biosynthetic process
cellular aromatic compound metabolic process
nitrogen compound metabolic process
'de novo' IMP biosynthetic process
nucleobase metabolic process
cellular nitrogen compound metabolic process
cellular metabolic process
purine base metabolic process
nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
purine base biosynthetic process
Gene Properties
Chromosome LocationNot Available
LocusYGL234W
Gene Sequence>2409 bp ATGCTCAACATTCTCGTTTTAGGAAACGGTGCAAGAGAACACGTTCTTGTCACCAAGCTG GCTCAGTCACCCACCGTGGGTAAGATCTATGTCGCTCCAGGTAATGGAGGGACCGCAACC ATGGATCCTTCGCGTGTGATAAACTGGGATATTACGCCAGATGTCGCCAATTTTGCTCGT TTGCAGTCGATGGCTGTGGAACATAAGATCAACTTGGTCGTTCCTGGTCCAGAATTACCT CTAGTCAACGGCATCACCTCCGTGTTCCATAGCGTTGGTATTCCCGTTTTTGGACCTTCC GTCAAAGCCGCTCAGTTGGAAGCTTCCAAGGCTTTCTCCAAGAGATTTATGTCAAAACAC AATATTCCAACCGCGTCTTATGATGTCTTCACTAATCCAGAAGAAGCCATTTCATTCTTG CAAGCTCATACTGACAAAGCTTTTGTCATCAAGGCCGACGGGATCGCTGCTGGGAAAGGT GTTATTATCCCATCTAGCATCGACGAGTCCGTCCAAGCTATCAAGGACATAATGGTCACC AAGCAATTCGGTGAAGAAGCGGGCAAGCAGGTTGTGATAGAACAATTCTTGGAAGGTGAT GAAATCTCTCTACTCACCATTGTTGACGGGTACTCTCACTTCAATCTCCCCGTCGCACAA GATCACAAGAGGATCTTTGATGGCGACAAGGGCTTGAACACCGGTGGGATGGGTGCCTAT GCCCCCGCTCCTGTGGCCACACCATCTTTGTTGAAGACCATAGATTCACAGATTGTGAAG CCTACGATTGATGGGATGAGACGTGATGGTATGCCCTTTGTTGGTGTGCTGTTCACCGGG ATGATTTTGGTGAAGGATTCTAAGACAAATCAACTTGTTCCCGAAGTGTTAGAATATAAT GTCAGATTCGGTGACCCAGAGACACAGGCTGTTTTGAGTTTACTTGATGATCAAACCGAT TTGGCGCAAGTGTTTTTGGCTGCTGCTGAACATCGTTTGGATTCCGTAAACATAGGAATC GATGACACAAGATCTGCCGTTACTGTCGTAGTGGCTGCAGGTGGTTATCCTGAATCATAC GCCAAAGGTGACAAAATTACCTTGGATACCGATAAATTACCTCCACATACACAAATCTTC CAAGCAGGTACCAAATACGATTCCGCCACCGATTCTTTATTGACCAATGGTGGTAGAGTT CTTTCTGTGACCTCCACTGCTCAGGACTTGAGAACAGCAGTAGATACAGTATATGAAGCC GTCAAATGCGTCCATTTCCAAAATTCTTACTACAGAAAGGACATCGCATACCGTGCGTTC CAAAACTCAGAATCATCAAAAGTTGCCATCACATACGCAGACTCAGGTGTCTCTGTTGAT AATGGTAACAATCTCGTACAAACTATCAAAGAAATGGTCAGATCCACAAGAAGGCCAGGT GCAGACTCTGATATTGGTGGTTTTGGTGGTTTATTCGATTTGGCTCAAGCAGGTTTCCGT CAAAACGAAGATACCTTACTAGTAGGTGCTACAGATGGTGTCGGTACTAAATTAATCATT GCCCAAGAGACCGGGATTCATAATACTGTCGGTATTGACCTGGTGGCCATGAATGTTAAC GATTTGGTGGTACAAGGTGCTGAGCCTCTATTCTTTTTGGACTACTTTGCCACTGGTGCT CTTGACATTCAAGTTGCCTCTGATTTTGTGTCCGGTGTTGCTAATGGTTGTATTCAAAGT GGTTGTGCTCTTGTGGGTGGTGAAACTTCGGAAATGCCCGGTATGTATCCACCCGGCCAC TACGATACTAATGGTACCGCTGTTGGTGCTGTATTAAGACAAGATATCTTGCCCAAGATA AATGAAATGGCCGCAGGAGATGTTCTTCTGGGTCTCGCCTCTAGCGGTGTTCATTCTAAT GGTTTCTCTTTGGTTAGAAAAATTATTCAACATGTAGCATTACCATGGGACGCTCCATGT CCATGGGATGAATCTAAGACGTTAGGTGAAGGTATTCTTGAACCAACAAAAATTTACGTC AAGCAATTATTGCCATCAATTAGACAAAGACTACTACTAGGTTTAGCTCATATAACAGGT GGTGGTTTAGTAGAGAATATCCCAAGAGCTATTCCAGACCACCTACAGGCCCGCGTTGAT ATGTCAACCTGGGAAGTACCCCGTGTCTTCAAATGGTTTGGTCAAGCAGGTAATGTTCCA CACGATGACATTTTAAGAACCTTCAACATGGGTGTTGGTATGGTTTTGATTGTCAAGAGA GAAAACGTCAAGGCTGTTTGTGATTCATTGACTGAAGAAGGTGAAATTATTTGGGAGCTT GGTTCTTTGCAAGAAAGACCAAAGGATGCTCCCGGTTGTGTGATTGAAAACGGAACTAAG CTTTACTAA
Protein Properties
Pfam Domain Function
Protein Residues802
Protein Molecular Weight86067.39844
Protein Theoretical pI4.89
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Bifunctional purine biosynthetic protein ADE5,7 MLNILVLGNGAREHVLVTKLAQSPTVGKIYVAPGNGGTATMDPSRVINWDITPDVANFAR LQSMAVEHKINLVVPGPELPLVNGITSVFHSVGIPVFGPSVKAAQLEASKAFSKRFMSKH NIPTASYDVFTNPEEAISFLQAHTDKAFVIKADGIAAGKGVIIPSSIDESVQAIKDIMVT KQFGEEAGKQVVIEQFLEGDEISLLTIVDGYSHFNLPVAQDHKRIFDGDKGLNTGGMGAY APAPVATPSLLKTIDSQIVKPTIDGMRRDGMPFVGVLFTGMILVKDSKTNQLVPEVLEYN VRFGDPETQAVLSLLDDQTDLAQVFLAAAEHRLDSVNIGIDDTRSAVTVVVAAGGYPESY AKGDKITLDTDKLPPHTQIFQAGTKYDSATDSLLTNGGRVLSVTSTAQDLRTAVDTVYEA VKCVHFQNSYYRKDIAYRAFQNSESSKVAITYADSGVSVDNGNNLVQTIKEMVRSTRRPG ADSDIGGFGGLFDLAQAGFRQNEDTLLVGATDGVGTKLIIAQETGIHNTVGIDLVAMNVN DLVVQGAEPLFFLDYFATGALDIQVASDFVSGVANGCIQSGCALVGGETSEMPGMYPPGH YDTNGTAVGAVLRQDILPKINEMAAGDVLLGLASSGVHSNGFSLVRKIIQHVALPWDAPC PWDESKTLGEGILEPTKIYVKQLLPSIRQRLLLGLAHITGGGLVENIPRAIPDHLQARVD MSTWEVPRVFKWFGQAGNVPHDDILRTFNMGVGMVLIVKRENVKAVCDSLTEEGEIIWEL GSLQERPKDAPGCVIENGTKLY
References
External Links
ResourceLink
Saccharomyces Genome Database ADE5
Uniprot IDP07244
Uniprot NamePUR2_YEAST
GenBank Gene IDX04337
Genebank Protein ID3335
General Reference
  • Henikoff, S. (1986). "The Saccharomyces cerevisiae ADE5,7 protein is homologous to overlapping Drosophila melanogaster Gart polypeptides." J Mol Biol 190:519-528.3097325
  • Tettelin, H., Agostoni Carbone, M. L., Albermann, K., Albers, M., Arroyo, J., Backes, U., Barreiros, T., Bertani, I., Bjourson, A. J., Bruckner, M., Bruschi, C. V., Carignani, G., Castagnoli, L., Cerdan, E., Clemente, M. L., Coblenz, A., Coglievina, M., Coissac, E., Defoor, E., Del Bino, S., Delius, H., Delneri, D., de Wergifosse, P., Dujon, B., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome VII." Nature 387:81-84.9169869
  • Boucherie, H., Dujardin, G., Kermorgant, M., Monribot, C., Slonimski, P., Perrot, M. (1995). "Two-dimensional protein map of Saccharomyces cerevisiae: construction of a gene-protein index." Yeast 11:601-613.7483834
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956