You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameThreonyl-tRNA synthetase, mitochondrial
Synonyms
  • Threonine--tRNA ligase
  • ThrRS
Gene NameMST1
Enzyme Class
Biological Properties
General FunctionInvolved in nucleotide binding
Specific FunctionATP + L-threonine + tRNA(Thr) = AMP + diphosphate + L-threonyl-tRNA(Thr)
Cellular LocationMitochondrion matrix
SMPDB PathwaysNot Available
KEGG PathwaysNot Available
SMPDB ReactionsNot Available
KEGG Reactions
Adenosine triphosphate + L-Threonine + tRNA(Thr) → Adenosine monophosphate + Pyrophosphate + Thr-tRNA(Thr)
Metabolites
YMDB IDNameView
YMDB00097Adenosine monophosphateShow
YMDB00109Adenosine triphosphateShow
YMDB00214L-ThreonineShow
YMDB00219PyrophosphateShow
GO Classification
Component
cell part
intracellular part
cytoplasm
Function
purine nucleoside binding
adenyl nucleotide binding
threonine-tRNA ligase activity
adenyl ribonucleotide binding
ATP binding
ligase activity, forming carbon-oxygen bonds
ligase activity, forming aminoacyl-tRNA and related compounds
catalytic activity
aminoacyl-tRNA ligase activity
nucleotide binding
ligase activity
binding
nucleoside binding
Process
translation
threonyl-tRNA aminoacylation
metabolic process
macromolecule metabolic process
cellular macromolecule metabolic process
RNA metabolic process
ncRNA metabolic process
biosynthetic process
tRNA metabolic process
tRNA aminoacylation
tRNA aminoacylation for protein translation
macromolecule biosynthetic process
cellular macromolecule biosynthetic process
Gene Properties
Chromosome Locationchromosome 11
LocusYKL194C
Gene Sequence>1389 bp ATGAAAATACAACTTGTAAGATGGCATTGTTCTCGCAATGCTCTTTGGAATCGTGCTTTC TACTCTACGAGAAAGGCCACTAAGAACGCTTCGTCGGCGACTCCAGCTACTATGACATCC ATGGTATCTCAGAGGCAAGATCTTTTCATGACAGATCCACTATCTCCTGGATCCATGTTC TTTCTTCCAAATGGTGCTAAGATTTTCAACAAATTGATAGAGTTTATGAAGTTACAACAA AAGTTCAAATTTGGTTTTAATGAAGTTGTGACGCCTTTGATTTACAAAAAGACTCTTTGG GAAAAGTCTGGTCACTGGGAAAATTATGCTGATGACATGTTTAAGGTGGAAACTACGGAT GAAGAAAAGGAGGAATACGGTTTAAAACCGATGAATTGCCCAGGCCATTGTCTGATCTTC GGTAAAAAGGATAGATCGTATAACGAACTTCCCCTACGCTTCTCTGATTTTTCACCACTA CATAGAAATGAAGCTTCTGGTGCACTGTCGGGATTGACTAGACTAAGGAAGTTCCATCAA GACGATGGTCATATCTTTTGCACTCCTTCCCAAGTGAAATCAGAAATTTTCAACTCTTTA AAATTAATCGACATAGTTTACAACAAAATTTTCCCCTTTGTTAAAGGAGGTTCTGGAGCA GAGAGCAATTATTTTATAAACTTTTCTACAAGACCGGATCACTTCATTGGAGACCTCAAA GTTTGGAATCATGCTGAGCAAGTACTCAAGGAAATCTTGGAAGAATCAGGCAAACCGTGG AAACTGAACCCTAGTGATGGTGCGTTCTATGGTCCAAAGTTGGATATAATGGTTACGGAC CATTTACGCAAAACTCATCAAGTCGCTACTATTCAGTTGGACTTTCAGCTACCTGAGAGG TTCGATTTGAAATTCAAGGATCAAGACAACTCGTACAAGAGGCCAATTATGATTCATAGA GCTACTTTTGGTTCTATCGAAAGATTTATGGCTTTACTGATAGATTCTAATGAGGGCCGT TGGCCGTTTTGGTTGAATCCTTACCAAGCTGTAATTATTCCCGTCAATACGAAAAATGTG CAACAGCTAGACATGTGCACTGCCTTGCAGAAAAAACTACGTAATGAACTGGAAGCCGAC GACATGGAACCAGTTCCTTTAAATGATTGGCATTTCAATGTTGATCTCGACATAAGAAAC GAACCCGTAGGGTATAGGATCAAGTCGGCCATTTTGAAAAACTATTCCTATTTAATTATC GTGGGTGATGAGGAAGTACAGTTACAGAAATACAACATTCGAGAACGTGATAATAGAAAG AGTTTCGAGAAACTTACAATGTCTCAAATTTGGGAAAAATTTATTGAGCTGGAAAAAAAC TACAAGTAA
Protein Properties
Pfam Domain Function
Protein Residues462
Protein Molecular Weight54091.60156
Protein Theoretical pI8.8
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Threonyl-tRNA synthetase, mitochondrial MKIQLVRWHCSRNALWNRAFYSTRKATKNASSATPATMTSMVSQRQDLFMTDPLSPGSMF FLPNGAKIFNKLIEFMKLQQKFKFGFNEVVTPLIYKKTLWEKSGHWENYADDMFKVETTD EEKEEYGLKPMNCPGHCLIFGKKDRSYNELPLRFSDFSPLHRNEASGALSGLTRLRKFHQ DDGHIFCTPSQVKSEIFNSLKLIDIVYNKIFPFVKGGSGAESNYFINFSTRPDHFIGDLK VWNHAEQVLKEILEESGKPWKLNPGDGAFYGPKLDIMVTDHLRKTHQVATIQLDFQLPER FDLKFKDQDNSYKRPIMIHRATFGSIERFMALLIDSNEGRWPFWLNPYQAVIIPVNTKNV QQLDMCTALQKKLRNELEADDMEPVPLNDWHFNVDLDIRNEPVGYRIKSAILKNYSYLII VGDEEVQLQKYNIRERDNRKSFEKLTMSQIWEKFIELEKNYK
References
External Links
ResourceLink
Saccharomyces Genome Database MST1
Uniprot IDP07236
Uniprot NameSYTM_YEAST
GenBank Gene IDM12087
Genebank Protein ID172012
General Reference
  • Pape, L. K., Koerner, T. J., Tzagoloff, A. (1985). "Characterization of a yeast nuclear gene (MST1) coding for the mitochondrial threonyl-tRNA1 synthetase." J Biol Chem 260:15362-15370.2999113
  • Dujon, B., Alexandraki, D., Andre, B., Ansorge, W., Baladron, V., Ballesta, J. P., Banrevi, A., Bolle, P. A., Bolotin-Fukuhara, M., Bossier, P., et, a. l. .. (1994). "Complete DNA sequence of yeast chromosome XI." Nature 369:371-378.8196765
  • MacKelvie, S. H., Andrews, P. D., Stark, M. J. (1995). "The Saccharomyces cerevisiae gene SDS22 encodes a potential regulator of the mitotic function of yeast type 1 protein phosphatase." Mol Cell Biol 15:3777-3785.7791785
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106