You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameHistidinol-phosphate aminotransferase
Synonyms
  • Imidazole acetol-phosphate transaminase
Gene NameHIS5
Enzyme Class
Biological Properties
General FunctionInvolved in transferase activity
Specific FunctionL-histidinol phosphate + 2-oxoglutarate = 3- (imidazol-4-yl)-2-oxopropyl phosphate + L-glutamate
Cellular LocationNot Available
SMPDB Pathways
Histidine BiosynthesisPW002418 ThumbThumb?image type=greyscaleThumb?image type=simple
Phenylalanine metabolismPW002437 ThumbThumb?image type=greyscaleThumb?image type=simple
Tyrosine metabolismPW002441 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Histidine metabolismec00340 Map00340
Phenylalanine metabolismec00360 Map00360
Phenylalanine, tyrosine and tryptophan biosynthesisec00400 Map00400
Tyrosine metabolismec00350 Map00350
SMPDB Reactions
Imidazole acetol-phosphate + L-Glutamic acidOxoglutaric acid + L-histidinol phosphate
KEGG Reactions
Imidazole acetol-phosphate + L-Glutamic acidL-histidinol phosphate + Oxoglutaric acid
Metabolites
YMDB IDNameView
YMDB00070Imidazole acetol-phosphateShow
YMDB00123L-histidinol phosphateShow
YMDB00153Oxoglutaric acidShow
YMDB00271L-Glutamic acidShow
GO Classification
Component
Not Available
Function
binding
transferase activity, transferring nitrogenous groups
transaminase activity
catalytic activity
transferase activity
cofactor binding
pyridoxal phosphate binding
histidinol-phosphate transaminase activity
Process
cellular amino acid and derivative metabolic process
cellular amino acid metabolic process
histidine family amino acid metabolic process
histidine metabolic process
metabolic process
histidine biosynthetic process
biosynthetic process
cellular metabolic process
Gene Properties
Chromosome Locationchromosome 9
LocusYIL116W
Gene Sequence>1158 bp ATGGTTTTTGATTTGAAAAGAATTGTTAGACCAAAAATTTATAACTTGGAACCTTATCGC TGTGCAAGAGATGATTTCACCGAGGGTATATTGCTAGACGCCAATGAAAATGCCCATGGA CCTACTCCAGTTGAATTGAGCAAGACCAATTTACATCGTTACCCGGATCCTCACCAATTG GAATTCAAGACCGCAATGACGAAATACAGGAACAAAACAAGCAGTTATGCCAATGACCCA GAGGTAAAACCTTTAACTGCTGACAATCTGTGCCTAGGTGTGGGATCTGATGAGAGTATT GATGCTATTATTAGAGCATGCTGTGTTCCCGGGAAAGAAAAGATTCTGGTTCTTCCACCA ACATATTCTATGTACTCTGTTTGTGCAAACATTAATGATATAGAAGTCGTCCAATGTCCT TTAACTGTTTCCGACGGTTCTTTTCAAATGGATACCGAAGCTGTATTAACCATTTTGAAA AACGACTCGCTAATTAAGTTGATGTTCGTTACTTCACCAGGTAATCCAACCGGAGCCAAA ATTAAGACCAGTTTAATCGAAAAGGTCTTACAGAATTGGGACAATGGGTTAGTCGTTGTT GATGAAGCTTACGTAGATTTTTGTGGTGGCTCTACAGCTCCACTAGTCACCAAGTATCCT AACTTGGTTACTTTGCAAACTCTATCCAAGTCATTCGGTTTAGCCGGGATTAGGTTGGGT ATGACATATGCAACAGCAGAGTTGGCCAGAATTTTAAATGCAATGAAGGCGCCTTATAAT ATTTCCTCCCTAGCCTCTGAATATGCACTAAAAGCTGTTCAAGACAGTAATCTAAAGAAG ATGGAAGCCACTTCGAAAATAATCAATGAAGAGAAAATGCGCCTCTTAAAGGAATTAACT GCTTTGGATTACGTTGATGACCAATATGTTGGTGGATTAGATGCTAATTTTCTTTTAATA CGGATCAACGGGGGTGACAATGTCTTGGCAAAGAAGTTATATTACCAATTGGCTACTCAA TCTGGGGTTGTCGTCAGATTTAGAGGTAACGAATTAGGCTGTTCCGGATGTTTGAGAATT ACCGTTGGAACCCATGAGGAGAACACACATTTGATAAAGTACTTCAAGGAGACGTTATAT AAGCTGGCCAATGAATAA
Protein Properties
Pfam Domain Function
Protein Residues385
Protein Molecular Weight42645.69922
Protein Theoretical pI6.37
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Histidinol-phosphate aminotransferase MVFDLKRIVRPKIYNLEPYRCARDDFTEGILLDANENAHGPTPVELSKTNLHRYPDPHQL EFKTAMTKYRNKTSSYANDPEVKPLTADNLCLGVGSDESIDAIIRACCVPGKEKILVLPP TYSMYSVCANINDIEVVQCPLTVSDGSFQMDTEAVLTILKNDSLIKLMFVTSPGNPTGAK IKTSLIEKVLQNWDNGLVVVDEAYVDFCGGSTAPLVTKYPNLVTLQTLSKSFGLAGIRLG MTYATAELARILNAMKAPYNISSLASEYALKAVQDSNLKKMEATSKIINEEKMRLLKELT ALDYVDDQYVGGLDANFLLIRINGGDNVLAKKLYYQLATQSGVVVRFRGNELGCSGCLRI TVGTHEENTHLIKYFKETLYKLANE
References
External Links
ResourceLink
Saccharomyces Genome Database HIS5
Uniprot IDP07172
Uniprot NameHIS8_YEAST
GenBank Gene IDZ38125
Genebank Protein ID558690
General Reference
  • Nishiwaki, K., Hayashi, N., Irie, S., Chung, D. H., Harashima, S., Oshima, Y. (1987). "Structure of the yeast HIS5 gene responsive to general control of amino acid biosynthesis." Mol Gen Genet 208:159-167.3302607
  • Churcher, C., Bowman, S., Badcock, K., Bankier, A., Brown, D., Chillingworth, T., Connor, R., Devlin, K., Gentles, S., Hamlin, N., Harris, D., Horsnell, T., Hunt, S., Jagels, K., Jones, M., Lye, G., Moule, S., Odell, C., Pearson, D., Rajandream, M., Rice, P., Rowley, N., Skelton, J., Smith, V., Barrell, B., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IX." Nature 387:84-87.9169870