You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameAdenylate kinase 1
Synonyms
  • AK 1
  • ATP-AMP transphosphorylase 1
  • Adenylate kinase cytosolic and mitochondrial
Gene NameADK1
Enzyme Class
Biological Properties
General FunctionInvolved in ATP binding
Specific FunctionCatalyzes the reversible transfer of the terminal phosphate group between ATP and AMP. Small ubiquitous enzyme involved in energy metabolism and nucleotide synthesis that is essential for maintenance and cell growth. Functions both in the cytoplasm and mitochondrion intermembrane space
Cellular LocationCytoplasm, cytosol. Mitochondrion intermembrane space
SMPDB PathwaysNot Available
KEGG Pathways
Purine metabolismec00230 Map00230
SMPDB ReactionsNot Available
KEGG Reactions
Adenosine monophosphate + Adenosine triphosphateADP
Adenosine monophosphate + GTPADP + Guanosine diphosphate
Adenosine monophosphate + ITPIDP + ADP
Metabolites
YMDB IDNameView
YMDB00097Adenosine monophosphateShow
YMDB00109Adenosine triphosphateShow
YMDB00257Guanosine diphosphateShow
YMDB00558GTPShow
YMDB00559ITPShow
YMDB00910IDPShow
YMDB00914ADPShow
GO Classification
Component
Not Available
Function
transferase activity, transferring phosphorus-containing groups
binding
nucleoside binding
purine nucleoside binding
adenyl nucleotide binding
adenyl ribonucleotide binding
ATP binding
kinase activity
nucleotide kinase activity
catalytic activity
phosphotransferase activity, phosphate group as acceptor
transferase activity
nucleobase, nucleoside, nucleotide kinase activity
adenylate kinase activity
Process
nitrogen compound metabolic process
cellular nitrogen compound metabolic process
nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
metabolic process
Gene Properties
Chromosome Locationchromosome 4
LocusYDR226W
Gene Sequence>669 bp ATGTCTAGCTCAGAATCCATTAGAATGGTCCTAATTGGCCCACCTGGTGCCGGTAAAGGT ACTCAAGCTCCAAATTTGCAAGAGCGTTTCCATGCCGCTCACTTGGCCACTGGTGACATG TTGAGATCTCAAATCGCAAAGGGCACTCAATTAGGTTTGGAAGCAAAGAAAATTATGGAC CAAGGTGGTTTAGTCTCTGATGACATTATGGTTAACATGATCAAGGATGAATTGACCAAC AATCCAGCTTGTAAGAATGGGTTCATCTTGGACGGTTTCCCAAAAACCATTCCTCAGGCT GAAAAATTGGACCAAATGTTGAAAGAACAAGGAACTCCTTTGGAAAAAGCCATCGAATTG AAGGTTGATGATGAATTGTTGGTTGCCAGAATTACCGGTAGATTAATTCACCCAGCCTCT GGCAGATCCTACCACAAGATCTTTAACCCACCAAAGGAAGACATGAAGGATGACGTCACC GGTGAAGCTTTAGTTCAAAGATCTGATGACAATGCAGACGCCTTGAAGAAGAGATTAGCT GCTTACCATGCTCAAACCGAACCAATTGTTGACTTTTACAAAAAGACCGGTATCTGGGCT GGTGTTGATGCTTCCCAACCTCCTGCTACTGTTTGGGCTGACATCTTGAACAAGCTAGGT AAGGATTAA
Protein Properties
Pfam Domain Function
Protein Residues222
Protein Molecular Weight24254.5
Protein Theoretical pI6.37
PDB Fileshow
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Adenylate kinase 1 MSSSESIRMVLIGPPGAGKGTQAPNLQERFHAAHLATGDMLRSQIAKGTQLGLEAKKIMD QGGLVSDDIMVNMIKDELTNNPACKNGFILDGFPRTIPQAEKLDQMLKEQGTPLEKAIEL KVDDELLVARITGRLIHPASGRSYHKIFNPPKEDMKDDVTGEALVQRSDDNADALKKRLA AYHAQTEPIVDFYKKTGIWAGVDASQPPATVWADILNKLGKD
References
External Links
ResourceLink
Saccharomyces Genome Database ADK1
Uniprot IDP07170
Uniprot NameKAD1_YEAST
GenBank Gene IDAY558578
Genebank Protein ID45271046
PDB ID
1AKY
General Reference
  • Magdolen, V., Oechsner, U., Bandlow, W. (1987). "The complete nucleotide sequence of the gene coding for yeast adenylate kinase." Curr Genet 12:405-411.2834097
  • Proba, K., Tomasselli, A. G., Nielsen, P., Schulz, G. E. (1987). "The cDNA sequence encoding cytosolic adenylate kinase from baker's yeast (Saccharomyces cerevisiae)." Nucleic Acids Res 15:7187.2821496
  • Konrad, M. (1988). "Analysis and in vivo disruption of the gene coding for adenylate kinase (ADK1) in the yeast Saccharomyces cerevisiae." J Biol Chem 263:19468-19474.2848829
  • Davies, C. J., Hutchison, C. A. 3rd (1995). "Insertion site specificity of the transposon Tn3." Nucleic Acids Res 23:507-514.7885847
  • Jacq, C., Alt-Morbe, J., Andre, B., Arnold, W., Bahr, A., Ballesta, J. P., Bargues, M., Baron, L., Becker, A., Biteau, N., Blocker, H., Blugeon, C., Boskovic, J., Brandt, P., Bruckner, M., Buitrago, M. J., Coster, F., Delaveau, T., del Rey, F., Dujon, B., Eide, L. G., Garcia-Cantalejo, J. M., Goffeau, A., Gomez-Peris, A., Zaccaria, P., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome IV." Nature 387:75-78.9169867
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Tomasselli, A. G., Mast, E., Janes, W., Schiltz, E. (1986). "The complete amino acid sequence of adenylate kinase from baker's yeast." Eur J Biochem 155:111-119.3004985
  • Schricker, R., Angermayr, M., Strobel, G., Klinke, S., Korber, D., Bandlow, W. (2002). "Redundant mitochondrial targeting signals in yeast adenylate kinase." J Biol Chem 277:28757-28764.12045196
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Abele, U., Schulz, G. E. (1995). "High-resolution structures of adenylate kinase from yeast ligated with inhibitor Ap5A, showing the pathway of phosphoryl transfer." Protein Sci 4:1262-1271.7670369
  • Schlauderer, G. J., Proba, K., Schulz, G. E. (1996). "Structure of a mutant adenylate kinase ligated with an ATP-analogue showing domain closure over ATP." J Mol Biol 256:223-227.8594191