You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameThymidylate synthase
Synonyms
  • TS
  • TSase
Gene NameTMP1
Enzyme Class
Biological Properties
General FunctionInvolved in thymidylate synthase activity
Specific FunctionRequired for both nuclear and mitochondrial DNA synthesis
Cellular LocationNot Available
SMPDB Pathways
One Carbon Pool by Folate IPW002468 ThumbThumb?image type=greyscaleThumb?image type=simple
Pyrimidine metabolismPW002469 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
One carbon pool by folateec00670 Map00670
Pyrimidine metabolismec00240 Map00240
SMPDB Reactions
Dihydrofolic acid + 5-Thymidylic acid5,10-Methylene-THF + dUMP
dUMP + 5,10-methenyltetrahydrofolate mono-L-glutamateDihydrofolic acid + 5-Thymidylic acid
KEGG Reactions
dUMP + 5,10-Methylene-THF5-Thymidylic acid + Dihydrofolic acid
Metabolites
YMDB IDNameView
YMDB00079Dihydrofolic acidShow
YMDB001625-Thymidylic acidShow
YMDB00221dUMPShow
YMDB002605,10-Methylene-THFShow
YMDB00848(6R)-5,10-methylenetetrahydrofolic acidShow
YMDB162795,10-methenyltetrahydrofolate mono-L-glutamateShow
GO Classification
Component
Not Available
Function
transferase activity, transferring one-carbon groups
methyltransferase activity
5,10-methylenetetrahydrofolate-dependent methyltransferase activity
thymidylate synthase activity
catalytic activity
transferase activity
Process
pyrimidine nucleotide metabolic process
pyrimidine nucleotide biosynthetic process
pyrimidine nucleoside monophosphate biosynthetic process
pyrimidine deoxyribonucleoside monophosphate biosynthetic process
dTMP biosynthetic process
metabolic process
nitrogen compound metabolic process
cellular nitrogen compound metabolic process
nucleobase, nucleoside, nucleotide and nucleic acid metabolic process
nucleobase, nucleoside and nucleotide metabolic process
nucleoside phosphate metabolic process
nucleotide metabolic process
Gene Properties
Chromosome LocationNot Available
LocusYOR074C
Gene Sequence>915 bp ATGACTATGGACGGAAAAAACAAAGAAGAAGAGCAATATCTTGATCTATGCAAAAGAATC ATTGATGAAGGTGAATTTAGGCCAGATAGAACAGGCACTGGTACGTTGAGTCTTTTTGCA CCACCCCAGCTGCGTTTTAGTTTACGTGATGATACCTTCCCACTACTAACGACCAAGAAG GTTTTTACTAGAGGTATCATACTTGAACTATTGTGGTTTTTGGCCGGTGATACAGACGCT AACCTATTGTCTGAGCAAGGTGTTAAGATTTGGGACGGTAATGGATCTCGTGAATATTTA GATAAGATGGGGTTCAAAGATAGGAAAGTAGGAGATCTGGGGCCCGTTTACGGATTTCAA TGGAGGCATTTTGGTGCTAAATACAAGACGTGCGATGACGACTATACTGGACAAGGTATT GATCAATTGAAACAGGTTATACATAAACTAAAGACAAATCCCTACGATAGAAGAATCATT ATGAGTGCCTGGAACCCAGCTGATTTTGACAAAATGGCTTTGCCGCCATGCCATATTTTT TCACAGTTCTATGTCAGTTTCCCCAAAGAAGGAGAAGGATCCGGTAAGCCCCGCCTTTCA TGCTTATTGTACCAACGTTCTTGTGATATGGGGTTGGGAGTACCATTTAACATTGCATCA TATGCTTTGTTGACTAGAATGATTGCTAAAGTTGTCGACATGGAGCCAGGTGAGTTCATT CATACTTTGGGGGATGCACATGTTTATAAAGACCACATTGATGCCTTGAAAGAACAAATC ACCAGAAATCCAAGACCATTCCCGAAACTAAAGATTAAAAGGGACGTTAAAGACATTGAT GATTTCAAGTTGACAGACTTTGAAATTGAAGATTATAATCCTCATCCAAGAATTCAAATG AAAATGAGTGTATAA
Protein Properties
Pfam Domain Function
Protein Residues304
Protein Molecular Weight35046.89844
Protein Theoretical pI7.16
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Thymidylate synthase MTMDGKNKEEEQYLDLCKRIIDEGEFRPDRTGTGTLSLFAPPQLRFSLRDDTFPLLTTKK VFTRGIILELLWFLAGDTDANLLSEQGVKIWDGNGSREYLDKMGFKDRKVGDLGPVYGFQ WRHFGAKYKTCDDDYTGQGIDQLKQVIHKLKTNPYDRRIIMSAWNPADFDKMALPPCHIF SQFYVSFPKEGEGSGKPRLSCLLYQRSCDMGLGVPFNIASYALLTRMIAKVVDMEPGEFI HTLGDAHVYKDHIDALKEQITRNPRPFPKLKIKRDVKDIDDFKLTDFEIEDYNPHPRIQM KMSV
References
External Links
ResourceLink
Saccharomyces Genome Database TMP1
Uniprot IDP06785
Uniprot NameTYSY_YEAST
GenBank Gene IDJ02706
Genebank Protein ID172990
General Reference
  • Taylor, G. R., Lagosky, P. A., Storms, R. K., Haynes, R. H. (1987). "Molecular characterization of the cell cycle-regulated thymidylate synthase gene of Saccharomyces cerevisiae." J Biol Chem 262:5298-5307.3031048
  • Valens, M., Bohn, C., Daignan-Fornier, B., Dang, V. D., Bolotin-Fukuhara, M. (1997). "The sequence of a 54.7 kb fragment of yeast chromosome XV reveals the presence of two tRNAs and 24 new open reading frames." Yeast 13:379-390.9133743
  • Dujon, B., Albermann, K., Aldea, M., Alexandraki, D., Ansorge, W., Arino, J., Benes, V., Bohn, C., Bolotin-Fukuhara, M., Bordonne, R., Boyer, J., Camasses, A., Casamayor, A., Casas, C., Cheret, G., Cziepluch, C., Daignan-Fornier, B., Dang, D. V., de Haan, M., Delius, H., Durand, P., Fairhead, C., Feldmann, H., Gaillon, L., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XV." Nature 387:98-102.9169874
  • McIntosh, E. M., Ord, R. W., Storms, R. K. (1988). "Transcriptional regulation of the cell cycle-dependent thymidylate synthase gene of Saccharomyces cerevisiae." Mol Cell Biol 8:4616-4624.3062362