You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameGlycogen phosphorylase
SynonymsNot Available
Gene NameGPH1
Enzyme Class
Biological Properties
General FunctionInvolved in phosphorylase activity
Specific FunctionPhosphorylase is an important allosteric enzyme in carbohydrate metabolism. Enzymes from different sources differ in their regulatory mechanisms and in their natural substrates. However, all known phosphorylases share catalytic and structural properties
Cellular LocationNot Available
SMPDB Pathways
Starch and sucrose metabolismPW002481 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Starch and sucrose metabolismec00500 Map00500
SMPDB ReactionsNot Available
KEGG Reactions
Glycogen + phosphateGlucose 1-phosphate
Metabolites
YMDB IDNameView
YMDB00288Glucose 1-phosphateShow
YMDB00881GlycogenShow
YMDB00907phosphateShow
GO Classification
Component
Not Available
Function
cofactor binding
pyridoxal phosphate binding
catalytic activity
phosphorylase activity
transferase activity
transferase activity, transferring glycosyl groups
transferase activity, transferring hexosyl groups
binding
Process
carbohydrate metabolic process
metabolic process
primary metabolic process
Gene Properties
Chromosome Locationchromosome 16
LocusYPR160W
Gene Sequence>2709 bp ATGCCGCCAGCTAGTACTAGTACTACCAATGATATGATAACCGAAGAACCTACTTCTCCA CACCAAATCCCAAGGCTTACAAGGAGACTTACGGGGTTTCTTCCCCAAGAAATCAAGTCA ATTGACACGATGATTCCTTTAAAGTCAAGAGCGTTATGGAATAAGCATCAAGTCAAAAAA TTTAACAAGGCAGAAGATTTTCAAGATAGATTCATTGACCATGTGGAAACTACATTAGCA CGTTCCCTATATAATTGTGATGACATGGCTGCTTATGAAGCTGCTTCGATGAGTATTCGT GACAATTTGGTCATTGACTGGAACAAAACTCAGCAGAAATTCACCACAAGAGACCCAAAG AGAGTTTACTATTTGTCTTTGGAGTTTTTGATGGGTAGGGCTTTGGATAATGCCCTGATT AATATGAAGATTGAAGATCCGGAAGACCCTGCTGCCTCAAAGGGAAAACCAAGAGAAATG ATTAAAGGGGCTTTGGATGAGGGAGGTTTCAAGTTAGAGGATGTCTTGGACCAAGAACCG GACGCAGGTTTAGGTAATGGTGGTCTAGGTCGTCTTGCAGCTTGCTTCGTCGACTCAATG GCAACGGAAGGCATCCCTGCCTGGGGTTATGGTCTACGTTATGAGTATGGTATCTTTGCT CAAAAGATTATTGACGGTTACCAGGTGGAAACTCCAGATTACTGGTTAAATTCTGGTAAT CCATGGGAAATTGAACGTAACGAAGTGCAAATTCCTGTCACCTTTTATGGTTATGTTGAT AGACCAGAAGGCGGTAAAACTACACTGAGTGCGTCACAATGGATCGGTGGGGAAAGAGTT CTTGCTGTCGCGTATGATTTCCCAGTTCCGGGTTTCAAGACTTCCAATGTAAATAACTTA AGACTATGGCAAGCAAGGCCAACAACAGAATTTGATTTTGCAAAATTCAATAATGGTGAC TATAAAAACTCTGTGCCTCAGCAACAACGCGCAGAGTCTATAACCGCTGTGTTGTATCCA AACGATAACTTTGCTCAAGGTAAGGAGTTGAGGTTGAAACAGCAGTACTTCTGGTGTGCT GCATCCTTACACGACATCTTAAGAAGATTCAAAAAATCCAAGAGGCCATGGACTGAATTT CCTGACCAAGTGGCTATTCAGTTGAATGATACTCATCCAACTTTAGCCATCGTTGAATTA CAGAGAGTTTTGGTCGATCTAGAAAAACTAGATTGGCACGAGGCTTGGGACATCGTGACC AAGACTTTTGCTTATACTAACCACACTGTTATGCAAGAGGCCCTGGAAAAATGGCCGCGT CGCCTCTTTGGCCATTTGCTACCCAGACATTTGGAAATTATATATGATATCAACTGGTTC TTCTTGCAAGATGTGGCCAAAAAATTCCCCAAGGATGTTGATCTTTTGTCTCGTATATCC ATCATCGAAGAAAACTCTCCAGAAAGACAGATCAGAATGGCCTTTTTGGCTATTGTTGGT TCACACAAGGTTAATGGTGTTGTTGAATTGCACTCTGAATTAATCAAAACGACCATATTT AAAGATTTTATCAAGTTCTATGGTCCATCAAAGTTTGTCAATGTCACTAACGGTATCACA CCAAGGAGATGGTTGAAGCAAGCTAACCCTTCATTGGCTAAACTGATCAGTGAAACCCTT AACGATCCAACAGAGGAGTATTTGTTGGACATGGCCAAACTGACCCAGTTGGAAAAATAT GTTGAAGATAAGGAGTTTTTGAAAAAATGGAACCAAGTCAAGCTTAATAATAAGATCAGA TTAGTAGATTTAATCAAAAAGGAAAATGATGGAGTAGACATCATTAACAGAGAGTATTTG GACGACACCTTGTTTGATATGCAAGTTAAACGTATTCATGAATATAAGCGTCAACAGCTA AACGTCTTTGGTATTATATACCGTTACCTGGCAATGAAGAATATGCTGAAGAACGGTGCT TCGATCGAAGAAGTTGCCAAGAAATATCCACGCAAGGTTTCAATCTTTGGTGGTAAGAGT GCTCCTGGTTACTACATGGCTAAGCTGATCATAAAATTGATCAACTGTGTTGCTGACATT GTTAATAACGACGAGTCAATTGAGCATTTGTTGAAGGTTGTCTTTGTTGCTGATTATAAT GTTTCTAAGGCTGAAATCATTATTCCAGCAAGTGACTTGAGTGAGCATATTTCTACTGCT GGTACTGAAGCGTCTGGTACTTCTAATATGAAGTTTGTTATGAACGGTGGTTTGATTATT GGTACTGTTGATGGTGCCAATGTGGAAATCACAAGGGAAATTGGTGAAGATAATGTCTTC TTGTTTGGTAACCTAAGTGAAAATGTCGAAGAATTGAGATACAACCATCAATACCATCCA CAAGATTTACCATCTAGTTTGGATTCTGTTTTATCCTACATTGAAAGTGGACAATTTTCT CCAGAAAATCCAAATGAATTCAAACCTTTAGTCGACAGTATTAAGTACCACGGCGATTAT TACCTGGTCAGTGATGACTTTGAATCCTATCTGGCCACCCATGAATTAGTGGACCAGGAG TTCCACAATCAAAGGTCAGAATGGTTAAAAAAGAGTGTCCTGAGCCTTGCAAACGTCGGC TTCTTTAGCAGTGATCGTTGTATCGAGGAATACTCCGATACCATTTGGAACGTTGAACCA GTGACTTAG
Protein Properties
Pfam Domain Function
Protein Residues902
Protein Molecular Weight103274.0
Protein Theoretical pI5.31
PDB Fileshow
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Glycogen phosphorylase MPPASTSTTNDMITEEPTSPHQIPRLTRRLTGFLPQEIKSIDTMIPLKSRALWNKHQVKK FNKAEDFQDRFIDHVETTLARSLYNCDDMAAYEAASMSIRDNLVIDWNKTQQKFTTRDPK RVYYLSLEFLMGRALDNALINMKIEDPEDPAASKGKPREMIKGALDDLGFKLEDVLDQEP DAGLGNGGLGRLAACFVDSMATEGIPAWGYGLRYEYGIFAQKIIDGYQVETPDYWLNSGN PWEIERNEVQIPVTFYGYVDRPEGGKTTLSASQWIGGERVLAVAYDFPVPGFKTSNVNNL RLWQARPTTEFDFAKFNNGDYKNSVAQQQRAESITAVLYPNDNFAQGKELRLKQQYFWCA ASLHDILRRFKKSKRPWTEFPDQVAIQLNDTHPTLAIVELQRVLVDLEKLDWHEAWDIVT KTFAYTNHTVMQEALEKWPVGLFGHLLPRHLEIIYDINWFFLQDVAKKFPKDVDLLSRIS IIEENSPERQIRMAFLAIVGSHKVNGVAELHSELIKTTIFKDFVKFYGPSKFVNVTNGIT PRRWLKQANPSLAKLISETLNDPTEEYLLDMAKLTQLGKYVEDKEFLKKWNQVKLNNKIR LVDLIKKENDGVDIINREYLDDTLFDMQVKRIHEYKRQQLNVFGIIYRYLAMKNMLKNGA SIEEVAKKYPRKVSIFGGKSAPGYYMAKLIIKLINCVADIVNNDESIEHLLKVVFVADYN VSKAEIIIPASDLSEHISTAGTEASGTSNMKFVMNGGLIIGTVDGANVEITREIGEDNVF LFGNLSENVEELRYNHQYHPQDLPSSLDSVLSYIESGQFSPENPNEFKPLVDSIKYHGDY YLVSDDFESYLATHELVDQEFHNQRSEWLKKSVLSVANVGFFSSDRCIEEYSDTIWNVEP VT
References
External Links
ResourceLink
Saccharomyces Genome Database GPH1
Uniprot IDP06738
Uniprot NamePHSG_YEAST
GenBank Gene IDL33835
Genebank Protein ID499700
PDB ID
1YGP
General Reference
  • Hwang, P. K., Fletterick, R. J. (1986). "Convergent and divergent evolution of regulatory sites in eukaryotic phosphorylases." Nature 324:80-84.3537803
  • Roemer, T., Fortin, N., Bussey, H. (1994). "DNA sequence analysis of a 10.4 kbp region on the right arm of yeast chromosome XVI positions GPH1 and SGV1 adjacent to KRE6, and identifies two novel tRNA genes." Yeast 10:1527-1530.7871892
  • Bussey, H., Storms, R. K., Ahmed, A., Albermann, K., Allen, E., Ansorge, W., Araujo, R., Aparicio, A., Barrell, B., Badcock, K., Benes, V., Botstein, D., Bowman, S., Bruckner, M., Carpenter, J., Cherry, J. M., Chung, E., Churcher, C., Coster, F., Davis, K., Davis, R. W., Dietrich, F. S., Delius, H., DiPaolo, T., Hani, J., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XVI." Nature 387:103-105.9169875
  • Rath, V. L., Hwang, P. K., Fletterick, R. J. (1992). "Purification and crystallization of glycogen phosphorylase from Saccharomyces cerevisiae." J Mol Biol 225:1027-1034.1613787
  • Lerch, K., Fischer, E. H. (1975). "Amino acid sequence of two functional sites in yeast glycogen phosphorylase." Biochemistry 14:2009-2014.1092346
  • Li, X., Gerber, S. A., Rudner, A. D., Beausoleil, S. A., Haas, W., Villen, J., Elias, J. E., Gygi, S. P. (2007). "Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae." J Proteome Res 6:1190-1197.17330950
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956
  • Lin, K., Rath, V. L., Dai, S. C., Fletterick, R. J., Hwang, P. K. (1996). "A protein phosphorylation switch at the conserved allosteric site in GP." Science 273:1539-1542.8703213
  • Becker, J. U., Wingender-Drissen, R., Schiltz, E. (1983). "Purification and properties of phosphorylase from baker's yeast." Arch Biochem Biophys 225:667-678.6354094