Survey with prize
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameCDP-diacylglycerol--inositol 3-phosphatidyltransferase
Synonyms
  • Phosphatidylinositol synthase
  • PI synthase
  • PtdIns synthase
Gene NamePIS1
Enzyme Class
Biological Properties
General FunctionInvolved in phosphotransferase activity, for other substituted phosphate groups
Specific FunctionCDP-diacylglycerol + myo-inositol = CMP + phosphatidyl-1D-myo-inositol
Cellular LocationMicrosome membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein. Mitochondrion outer membrane
SMPDB Pathways
Glycerophospholipid metabolismPW002493 ThumbThumb?image type=greyscaleThumb?image type=simple
Inositol phosphate metabolismPW002495 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Glycerophospholipid metabolismec00564 Map00564
Inositol phosphate metabolismec00562 Map00562
SMPDB ReactionsNot Available
KEGG Reactions
Myoinositol + CDP-diacylglycerol → Cytidine monophosphate + 1-Phosphatidyl-D-myo-inositol + hydron
Myoinositol + CDP-diacylglycerol ↔ Cytidine monophosphate + 1-Phosphatidyl-D-myo-inositol + hydron
Metabolites
YMDB IDNameView
YMDB00173MyoinositolShow
YMDB002301-Phosphatidyl-D-myo-inositolShow
YMDB00406Cytidine monophosphateShow
YMDB00862hydronShow
GO Classification
Component
cell part
membrane
Function
phosphotransferase activity, for other substituted phosphate groups
catalytic activity
transferase activity
transferase activity, transferring phosphorus-containing groups
Process
organophosphate metabolic process
phospholipid metabolic process
phospholipid biosynthetic process
metabolic process
Gene Properties
Chromosome Locationchromosome 16
LocusYPR113W
Gene Sequence>663 bp ATGAGTTCGAATTCAACACCAGAAAAGGTTACTGCAGAACACGTTCTGTGGTATATTCCC AATAAGATCGGTTATGTTCGTGTTATCACCGCCGCCCTTTCTTTTTTCGTTATGAAGAAT CATCCTACGGCCTTTACATGGTTGTATAGTACATCATGTCTACTGGATGCGCTAGACGGA ACCATGGCAAGAAAGTACAATCAGGTTTCCAGTCTGGGTGCCGTTCTGGACATGGTTACC GACAGATCCAGTACCGCTGGCTTGATGTGTTTCCTTTGTGTGCAGTATCCCCAATGGTGC GTTTTCTTCCAATTAATGCTGGGCTTGGATATTACTAGTCACTACATGCATATGTATGCC AGTTTAAGTGCTGGTAAGACTTCTCATAAAAGTGTGGGCGAGGGTGAGTCCAGATTGTTA CACCTGTACTACACGAGAAGAGACGTACTGTTCACTATCTGTGCGTTTAACGAACTATTT TATGCTGGATTGTACTTGCAGTTGTTCTCAAATTCTGCAACCTTTGGTAAATGGACTACA ATCATAAGTTTCCCTGGTTACGTGTTCAAGCAGACCGCAAACGTTGTCCAGCTAAAAAGG GCAGCCTTGATTTTAGCAGACAACGATGCCAAGAATGCCAACGAGAAGAACAAGACTTAC TGA
Protein Properties
Pfam Domain Function
Protein Residues220
Protein Molecular Weight24823.5
Protein Theoretical pI8.87
Signalling Regions
  • None
Transmembrane Regions
  • 21-41
  • 46-66
  • 76-96
  • 99-119
  • 146-166
  • 171-191
Protein Sequence>CDP-diacylglycerol--inositol 3-phosphatidyltransferase MSSNSTPEKVTAEHVLWYIPNKIGYVRVITAALSFFVMKNHPTAFTWLYSTSCLLDALDG TMARKYNQVSSLGAVLDMVTDRSSTAGLMCFLCVQYPQWCVFFQLMLGLDITSHYMHMYA SLSAGKTSHKSVGEGESRLLHLYYTRRDVLFTICAFNELFYAGLYLQLFSNSATFGKWTT IISFPGYVFKQTANVVQLKRAALILADNDAKNANEKNKTY
References
External Links
ResourceLink
Saccharomyces Genome Database PIS1
Uniprot IDP06197
Uniprot NamePIS_YEAST
GenBank Gene IDJ02697
Genebank Protein ID172173
General Reference
  • Nikawa, J., Kodaki, T., Yamashita, S. (1987). "Primary structure and disruption of the phosphatidylinositol synthase gene of Saccharomyces cerevisiae." J Biol Chem 262:4876-4881.3031032
  • Bussey, H., Storms, R. K., Ahmed, A., Albermann, K., Allen, E., Ansorge, W., Araujo, R., Aparicio, A., Barrell, B., Badcock, K., Benes, V., Botstein, D., Bowman, S., Bruckner, M., Carpenter, J., Cherry, J. M., Chung, E., Churcher, C., Coster, F., Davis, K., Davis, R. W., Dietrich, F. S., Delius, H., DiPaolo, T., Hani, J., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome XVI." Nature 387:103-105.9169875
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Kim, H., Melen, K., Osterberg, M., von Heijne, G. (2006). "A global topology map of the Saccharomyces cerevisiae membrane proteome." Proc Natl Acad Sci U S A 103:11142-11147.16847258