You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameCatalase T
SynonymsNot Available
Gene NameCTT1
Enzyme Class
Biological Properties
General FunctionInvolved in catalase activity
Specific FunctionOccurs in almost all aerobically respiring organisms and serves to protect cells from the toxic effects of hydrogen peroxide
Cellular LocationCytoplasm
SMPDB Pathways
Stress-activated signalling pathways: high osmolarity test 1PW002773 ThumbThumb?image type=greyscaleThumb?image type=simple
Tryptophan metabolismPW002442 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Methane metabolismec00680 Map00680
Tryptophan metabolismec00380 Map00380
SMPDB ReactionsNot Available
KEGG Reactions
Hydrogen peroxidewater + oxygen
Metabolites
YMDB IDNameView
YMDB00888Hydrogen peroxideShow
YMDB00890waterShow
YMDB00900oxygenShow
GO Classification
Component
Not Available
Function
binding
ion binding
cation binding
metal ion binding
transition metal ion binding
iron ion binding
heme binding
antioxidant activity
peroxidase activity
catalase activity
Process
oxidation reduction
response to stimulus
response to stress
response to oxidative stress
metabolic process
Gene Properties
Chromosome Locationchromosome 7
LocusYGR088W
Gene Sequence>1689 bp ATGAACGTGTTCGGTAAAAAAGAAGAAAAGCAAGAAAAAGTTTACTCTCTACAAAACGGT TTTCCGTACTCTCATCACCCATACGCTTCTCAATACTCAAGACCAGACGGCCCTATCTTA CTGCAAGACTTCCATCTGCTGGAAAATATCGCAAGTTTCGATAGAGAAAGAGTTCCGGAG CGTGTAGTCCATGCCAAAGGTGGTGGTTGTAGACTGGAGTTCGAACTAACAGATTCTTTG AGTGATATTACATACGCCGCTCCATACCAGAATGTGGGTTACAAATGTCCTGGTCTTGTT CGTTTTTCCACCGTTGGTGGTGAAAGTGGTACACCAGACACTGCAAGAGACCCAAGAGGT GTTTCTTTTAAATTCTATACCGAGTGGGGGAACCATGACTGGGTCTTCAACAATACTCCC GTCTTCTTCCTCAGAGACGCTATTAAGTTTCCCGTATTTATTCATTCGCAAAAGAGAGAC CCTCAGTCTCATCTGAATCAGTTTCAGGACACTACCATATACTGGGATTATCTAACATTG AATCCGGAATCAATCCATCAAATAACTTACATGTTTGGTGATAGAGGTACTCCTGCTTCG TGGGCTAGTATGAACGCGTACTCTGGTCATTCCTTCATCATGGTCAACAAAGAAGGTAAG GACACATATGTGCAATTCCACGTCTTGTCGGATACTGGTTTTGAAACCTTGACTGGAGAT AAGGCTGCTGAACTGTCAGGCTCCCACCCTGATTATAATCAGGCAAAGCTGTTCACTCAA TTGCAAAATGGCGAAAAGCCAAAATTTAACTGTTATGTGCAAACAATGACACCCGAACAA GCAACTAAGTTCAGGTATTCGGTAAATGACCTAACGAAAATATGGCCACACAAGGAATTC CCTTTGAGAAAATTTGGTACCATCACCCTAACGGAGAATGTTGACAATTATTTCCAAGAA ATTGAACAAGTTGCATTCAGTCCAACGAACACTTGTATCCCAGGTATTAAGCCTTCTAAT GATTCCGTTCTACAAGCCAGACTTTTCTCCTATCCAGACACTCAACGTCATAGATTGGGA GCCAACTATCAGCAATTGCCCGTCAACAGACCAAGAAACTTGGGATGTCCATACTCCAAA GGTGATTCCCAATACACTGCCGAACAGTGTCCATTTAAAGCAGTGAACTTCCAAAGGGAC GGCCCAATGAGTTACTACAATTTCGGTCCTGAGCCAAATTATATTTCCAGTTTACCAAAT CAAACTCTGAAATTCAAAAATGAAGTCAACGACGAAGTATCTGATAAGTTCAAAGGGATA GTTCTTGACGAAGTAACAGAAGTTTCTGTGAGAAAACAGGAACAAGACCAAATCAGAAAC GAGCATATTGTTGATGCCAAAATTAATCAATATTACTACGTTTATGGTATTAGTCCACTA GACTTCGAACAGCCAAGAGCTCTATATGAAAAGGTATACAACGATGAACAGAAGAAATTA TTCGTTCATAACGTTGTTTGCCACGCTTGTAAGATCAAAGATCCTAAAGTCAAAAAGAGA GTTACGCAATACTTTGGTTTGCTAAACGAAGATTTGGGTAAAGTCATTGCAGAAGGCTTG GGAGTTCCTTGGGAACCTGTTGACCTTGAAGGTTATGCCAAGACTTGGTCCATTGCAAGT GCCAATTAA
Protein Properties
Pfam Domain Function
Protein Residues562
Protein Molecular Weight64583.0
Protein Theoretical pI6.51
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Catalase T MNVFGKKEEKQEKVYSLQNGFPYSHHPYASQYSRPDGPILLQDFHLLENIASFDRERVPE RVVHAKGGGCRLEFELTDSLSDITYAAPYQNVGYKCPGLVRFSTVGGESGTPDTARDPRG VSFKFYTEWGNHDWVFNNTPVFFLRDAIKFPVFIHSQKRDPQSHLNQFQDTTIYWDYLTL NPESIHQITYMFGDRGTPASWASMNAYSGHSFIMVNKEGKDTYVQFHVLSDTGFETLTGD KAAELSGSHPDYNQAKLFTQLQNGEKPKFNCYVQTMTPEQATKFRYSVNDLTKIWPHKEF PLRKFGTITLTENVDNYFQEIEQVAFSPTNTCIPGIKPSNDSVLQARLFSYPDTQRHRLG ANYQQLPVNRPRNLGCPYSKGDSQYTAEQCPFKAVNFQRDGPMSYYNFGPEPNYISSLPN QTLKFKNEDNDEVSDKFKGIVLDEVTEVSVRKQEQDQIRNEHIVDAKINQYYYVYGISPL DFEQPRALYEKVYNDEQKKLFVHNVVCHACKIKDPKVKKRVTQYFGLLNEDLGKVIAECL GVPWEPVDLEGYAKTWSIASAN
References
External Links
ResourceLink
Saccharomyces Genome Database CTT1
Uniprot IDP06115
Uniprot NameCATT_YEAST
GenBank Gene IDX04625
Genebank Protein ID3608
General Reference
  • Hartig, A., Ruis, H. (1986). "Nucleotide sequence of the Saccharomyces cerevisiae CTT1 gene and deduced amino-acid sequence of yeast catalase T." Eur J Biochem 160:487-490.3536508
  • Tettelin, H., Agostoni Carbone, M. L., Albermann, K., Albers, M., Arroyo, J., Backes, U., Barreiros, T., Bertani, I., Bjourson, A. J., Bruckner, M., Bruschi, C. V., Carignani, G., Castagnoli, L., Cerdan, E., Clemente, M. L., Coblenz, A., Coglievina, M., Coissac, E., Defoor, E., Del Bino, S., Delius, H., Delneri, D., de Wergifosse, P., Dujon, B., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome VII." Nature 387:81-84.9169869
  • Spevak, W., Hartig, A., Meindl, P., Ruis, H. (1986). "Heme control region of the catalase T gene of the yeast Saccharomyces cerevisiae." Mol Gen Genet 203:73-78.2423850
  • Norbeck, J., Blomberg, A. (1997). "Metabolic and regulatory changes associated with growth of Saccharomyces cerevisiae in 1.4 M NaCl. Evidence for osmotic induction of glycerol dissimilation via the dihydroxyacetone pathway." J Biol Chem 272:5544-5554.9038161
  • Huh, W. K., Falvo, J. V., Gerke, L. C., Carroll, A. S., Howson, R. W., Weissman, J. S., O'Shea, E. K. (2003). "Global analysis of protein localization in budding yeast." Nature 425:686-691.14562095
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Zhang, Z., Dietrich, F. S. (2005). "Mapping of transcription start sites in Saccharomyces cerevisiae using 5' SAGE." Nucleic Acids Res 33:2838-2851.15905473
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956