Canmetcon
You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NamePhosphatidylethanolamine N-methyltransferase
Synonyms
  • PEAMT
Gene NamePEM1
Enzyme Class
Biological Properties
General FunctionInvolved in phosphatidylethanolamine N-methyltransferas
Specific FunctionS-adenosyl-L-methionine + phosphatidylethanolamine = S-adenosyl-L-homocysteine + phosphatidyl-N-methylethanolamine
Cellular LocationMembrane; Multi-pass membrane protein
SMPDB Pathways
Glycerophospholipid metabolismPW002493 ThumbThumb?image type=greyscaleThumb?image type=simple
Lysolipid incorporation into ERPW002532 ThumbThumb?image type=greyscaleThumb?image type=simple
Lysolipid incorporation into ER PC(10:0/10:0)PW002780 ThumbThumb?image type=greyscaleThumb?image type=simple
Lysolipid incorporation into ER PC(14:0/14:0)PW002783 ThumbThumb?image type=greyscaleThumb?image type=simple
Lysolipid incorporation into ER PC(16:0/16:0)PW002784 ThumbThumb?image type=greyscaleThumb?image type=simple
KEGG Pathways
Glycerophospholipid metabolismec00564 Map00564
SMPDB Reactions
PE(14:0/14:0) + S-Adenosyl-L-methioninePE-NMe(14:0/14:0) + hydron + S-Adenosylhomocysteine
PE(14:0/14:0) + S-Adenosyl-L-methioninePE-NMe(16:0/16:0) + hydron + S-Adenosylhomocysteine
PE(16:0/16:0) + S-Adenosyl-L-methioninePE-NMe(16:0/16:0) + hydron + S-Adenosylhomocysteine
PE(10:0/10:0) + S-Adenosyl-L-methioninePE-NMe(10:0/10:0) + hydron + S-Adenosylhomocysteine
PE(16:1(9Z)/16:1(9Z)) + S-Adenosyl-L-methioninePE-NMe(16:1(9Z)/16:1(9Z)) + hydron + S-Adenosylhomocysteine
KEGG Reactions
PE(14:0/16:1(9Z)) + S-AdenosylmethionineS-Adenosylhomocysteine + phosphatidyl-N-methylethanolamine + hydron
Metabolites
YMDB IDNameView
YMDB00198S-AdenosylhomocysteineShow
YMDB00297S-AdenosylmethionineShow
YMDB00438S-Adenosyl-L-methionineShow
YMDB00862hydronShow
YMDB01192PE(12:0/16:0)Show
YMDB01193PE(12:0/16:1(9Z))Show
YMDB01195PE(14:0/16:1(9Z))Show
YMDB01196PE(14:1(9Z)/16:0)Show
YMDB01198PE(16:0/16:0)Show
YMDB01199PE(16:0/16:1(9Z))Show
YMDB01200PE(16:0/18:1(9Z))Show
YMDB01202PE(16:1(9Z)/16:1(9Z))Show
YMDB01203PE(16:1(9Z)/18:1(9Z))Show
YMDB01206PE(18:0/18:1(9Z))Show
YMDB01208PE(18:1(9Z)/18:1(9Z))Show
YMDB13852PE-NMe(10:0/10:0)Show
YMDB13853PE-NMe(10:0/12:0)Show
YMDB13854PE-NMe(10:0/14:0)Show
YMDB13855PE-NMe(10:0/15:0)Show
YMDB13856PE-NMe(10:0/16:0)Show
YMDB13857PE-NMe(12:0/12:0)Show
YMDB13858PE-NMe(12:0/14:0)Show
YMDB13859PE-NMe(12:0/15:0)Show
YMDB13860PE-NMe(14:0/14:0)Show
YMDB13861PE-NMe(12:0/16:0)Show
YMDB13862PE-NMe(14:0/15:0)Show
YMDB13863PE-NMe(10:0/14:1(9Z))Show
YMDB13864PE-NMe(10:0/14:1(11Z))Show
YMDB13865PE-NMe(12:0/14:1(9Z))Show
YMDB13866PE-NMe(12:0/14:1(11Z))Show
YMDB13867PE-NMe(14:0/14:1(9Z))Show
YMDB13868PE-NMe(14:0/14:1(11Z))Show
YMDB13869PE-NMe(14:1(9Z)/15:0)Show
YMDB13870PE-NMe(14:1(11Z)/15:0)Show
YMDB13871PE-NMe(15:0/15:0)Show
YMDB13872PE-NMe(10:0/20:1(13Z))Show
YMDB13873PE-NMe(10:0/20:1(11Z))Show
YMDB13874PE-NMe(10:0/15:1(9Z))Show
YMDB13875PE-NMe(10:0/15:1(11Z))Show
YMDB13876PE-NMe(10:0/16:1(9Z))Show
YMDB13877PE-NMe(10:0/16:1(11Z))Show
YMDB13878PE-NMe(12:0/18:1(9Z))Show
YMDB13879PE-NMe(12:0/18:1(11Z))Show
YMDB13880PE-NMe(12:0/15:1(9Z))Show
YMDB13881PE-NMe(12:0/15:1(11Z))Show
YMDB13882PE-NMe(14:0/16:1(9Z))Show
YMDB13883PE-NMe(14:0/16:1(11Z))Show
YMDB13884PE-NMe(14:0/15:1(9Z))Show
YMDB13885PE-NMe(14:0/15:1(11Z))Show
YMDB13886PE-NMe(14:1(9Z)/16:0)Show
YMDB13887PE-NMe(14:1(11Z)/16:0)Show
YMDB13888PE-NMe(15:0/15:1(9Z))Show
YMDB13889PE-NMe(15:0/15:1(11Z))Show
YMDB13890PE-NMe(12:0/16:1(9Z))Show
YMDB13891PE-NMe(12:0/16:1(11Z))Show
YMDB13892PE-NMe(14:1(9Z)/14:1(9Z))Show
YMDB13893PE-NMe(14:1(9Z)/14:1(11Z))Show
YMDB13894PE-NMe(14:1(11Z)/14:1(9Z))Show
YMDB13895PE-NMe(14:1(11Z)/14:1(11Z))Show
YMDB13896PE-NMe(14:1(9Z)/15:1(9Z))Show
YMDB13897PE-NMe(14:1(9Z)/15:1(11Z))Show
YMDB13898PE-NMe(14:1(11Z)/15:1(9Z))Show
YMDB13899PE-NMe(14:1(11Z)/15:1(11Z))Show
YMDB13900PE-NMe(14:1(9Z)/16:1(9Z))Show
YMDB13901PE-NMe(14:1(9Z)/16:1(11Z))Show
YMDB13902PE-NMe(14:1(11Z)/16:1(9Z))Show
YMDB13903PE-NMe(14:1(11Z)/16:1(11Z))Show
YMDB13904PE-NMe(15:1(9Z)/15:1(9Z))Show
YMDB13905PE-NMe(15:1(9Z)/15:1(11Z))Show
YMDB13906PE-NMe(15:1(11Z)/15:1(9Z))Show
YMDB13907PE-NMe(15:1(11Z)/15:1(11Z))Show
YMDB13908PE-NMe(15:1(9Z)/16:1(9Z))Show
YMDB13909PE-NMe(15:1(9Z)/16:1(11Z))Show
YMDB13910PE-NMe(15:1(11Z)/16:1(9Z))Show
YMDB13911PE-NMe(15:1(11Z)/16:1(11Z))Show
YMDB13912PE-NMe(14:0/16:0)Show
YMDB13913PE-NMe(15:0/16:1(9Z))Show
YMDB13914PE-NMe(15:0/16:1(11Z))Show
YMDB13915PE-NMe(15:1(9Z)/16:0)Show
YMDB13916PE-NMe(15:1(11Z)/16:0)Show
YMDB13917PE-NMe(14:1(9Z)/18:1(9Z))Show
YMDB13918PE-NMe(14:1(9Z)/18:1(11Z))Show
YMDB13919PE-NMe(14:1(11Z)/18:1(9Z))Show
YMDB13920PE-NMe(14:1(11Z)/18:1(11Z))Show
YMDB13921PE-NMe(16:1(9Z)/16:1(9Z))Show
YMDB13922PE-NMe(16:1(9Z)/16:1(11Z))Show
YMDB13923PE-NMe(16:1(11Z)/16:1(9Z))Show
YMDB13924PE-NMe(16:1(11Z)/16:1(11Z))Show
YMDB13925PE-NMe(10:0/18:1(9Z))Show
YMDB13926PE-NMe(10:0/18:1(11Z))Show
YMDB13927PE-NMe(16:0/16:1(9Z))Show
YMDB13928PE-NMe(16:0/16:1(11Z))Show
YMDB13929PE-NMe(10:0/22:1(9Z))Show
YMDB13930PE-NMe(10:0/22:1(11Z))Show
YMDB13931PE-NMe(10:0/18:0)Show
YMDB13932PE-NMe(12:0/20:1(13Z))Show
YMDB13933PE-NMe(12:0/20:1(11Z))Show
YMDB13934PE-NMe(14:0/18:1(9Z))Show
YMDB13935PE-NMe(14:0/18:1(11Z))Show
YMDB13936PE-NMe(14:1(9Z)/18:0)Show
YMDB13937PE-NMe(14:1(11Z)/18:0)Show
YMDB13938PE-NMe(16:0/16:0)Show
YMDB13939PE-NMe(15:1(9Z)/18:1(9Z))Show
YMDB13940PE-NMe(15:1(9Z)/18:1(11Z))Show
YMDB13941PE-NMe(15:1(11Z)/18:1(9Z))Show
YMDB13942PE-NMe(15:1(11Z)/18:1(11Z))Show
YMDB13943PE-NMe(10:0/23:1(9Z))Show
YMDB13944PE-NMe(10:0/23:1(11Z))Show
YMDB13945PE-NMe(12:0/18:0)Show
YMDB13946PE-NMe(15:0/18:1(9Z))Show
YMDB13947PE-NMe(15:0/18:1(11Z))Show
YMDB13948PE-NMe(15:1(9Z)/18:0)Show
YMDB13949PE-NMe(15:1(11Z)/18:0)Show
YMDB13950PE-NMe(14:1(9Z)/20:1(13Z))Show
YMDB13951PE-NMe(14:1(9Z)/20:1(11Z))Show
YMDB13952PE-NMe(14:1(11Z)/20:1(13Z))Show
YMDB13953PE-NMe(14:1(11Z)/20:1(11Z))Show
YMDB13954PE-NMe(16:1(9Z)/18:1(9Z))Show
YMDB13955PE-NMe(16:1(9Z)/18:1(11Z))Show
YMDB13956PE-NMe(16:1(11Z)/18:1(9Z))Show
YMDB13957PE-NMe(16:1(11Z)/18:1(11Z))Show
YMDB13958PE-NMe(10:0/24:1(9Z))Show
YMDB13959PE-NMe(10:0/24:1(11Z))Show
YMDB13960PE-NMe(12:0/22:1(9Z))Show
YMDB13961PE-NMe(12:0/22:1(11Z))Show
YMDB13962PE-NMe(14:0/20:1(13Z))Show
YMDB13963PE-NMe(14:0/20:1(11Z))Show
YMDB13964PE-NMe(14:0/18:0)Show
YMDB13965PE-NMe(14:1(9Z)/20:0)Show
YMDB13966PE-NMe(14:1(11Z)/20:0)Show
YMDB13967PE-NMe(16:0/18:1(9Z))Show
YMDB13968PE-NMe(16:0/18:1(11Z))Show
YMDB13969PE-NMe(16:1(9Z)/18:0)Show
YMDB13970PE-NMe(16:1(11Z)/18:0)Show
YMDB13971PE-NMe(15:1(9Z)/20:1(13Z))Show
YMDB13972PE-NMe(15:1(9Z)/20:1(11Z))Show
YMDB13973PE-NMe(15:1(11Z)/20:1(13Z))Show
YMDB13974PE-NMe(15:1(11Z)/20:1(11Z))Show
YMDB13975PE-NMe(10:0/25:1(9Z))Show
YMDB13976PE-NMe(10:0/25:1(11Z))Show
YMDB13977PE-NMe(10:0/20:0)Show
YMDB13978PE-NMe(12:0/23:1(9Z))Show
YMDB13979PE-NMe(12:0/23:1(11Z))Show
YMDB13980PE-NMe(15:0/20:1(13Z))Show
YMDB13981PE-NMe(15:0/20:1(11Z))Show
YMDB13982PE-NMe(15:0/16:0)Show
YMDB13983PE-NMe(15:1(9Z)/20:0)Show
YMDB13984PE-NMe(15:1(11Z)/20:0)Show
YMDB13985PE-NMe(16:0/18:0)Show
YMDB13986PE-NMe(14:1(9Z)/22:1(9Z))Show
YMDB13987PE-NMe(14:1(9Z)/22:1(11Z))Show
YMDB13988PE-NMe(14:1(11Z)/22:1(9Z))Show
YMDB13989PE-NMe(14:1(11Z)/22:1(11Z))Show
YMDB13990PE-NMe(16:1(9Z)/20:1(13Z))Show
YMDB13991PE-NMe(16:1(9Z)/20:1(11Z))Show
YMDB13992PE-NMe(16:1(11Z)/20:1(13Z))Show
YMDB13993PE-NMe(16:1(11Z)/20:1(11Z))Show
YMDB13994PE-NMe(18:1(9Z)/18:1(9Z))Show
YMDB13995PE-NMe(18:1(9Z)/18:1(11Z))Show
YMDB13996PE-NMe(18:1(11Z)/18:1(9Z))Show
YMDB13997PE-NMe(18:1(11Z)/18:1(11Z))Show
YMDB13998PE-NMe(18:0/18:1(9Z))Show
YMDB13999PE-NMe(18:0/18:1(11Z))Show
YMDB14000PE-NMe(10:0/26:1(9Z))Show
YMDB14001PE-NMe(10:0/26:1(11Z))Show
YMDB14002PE-NMe(12:0/24:1(9Z))Show
YMDB14003PE-NMe(12:0/24:1(11Z))Show
YMDB14004PE-NMe(12:0/20:0)Show
YMDB14005PE-NMe(14:0/22:1(9Z))Show
YMDB14006PE-NMe(14:0/22:1(11Z))Show
YMDB14007PE-NMe(14:1(9Z)/22:0)Show
YMDB14008PE-NMe(14:1(11Z)/22:0)Show
YMDB14009PE-NMe(16:0/20:1(13Z))Show
YMDB14010PE-NMe(16:0/20:1(11Z))Show
YMDB14011PE-NMe(16:1(9Z)/20:0)Show
YMDB14012PE-NMe(16:1(11Z)/20:0)Show
YMDB14013PE-NMe(18:0/18:0)Show
YMDB14014PE(10:0/10:0)Show
YMDB14015PE(10:0/12:0)Show
YMDB14017PE(10:0/15:0)Show
YMDB14018PE(10:0/16:0)Show
YMDB14019PE(12:0/12:0)Show
YMDB14020PE(12:0/14:0)Show
YMDB14021PE(12:0/15:0)Show
YMDB14022PE(14:0/14:0)Show
YMDB14023PE(14:0/15:0)Show
YMDB14024PE(10:0/14:1(9Z))Show
YMDB14025PE(10:0/14:1(11Z))Show
YMDB14026PE(12:0/14:1(9Z))Show
YMDB14027PE(12:0/14:1(11Z))Show
YMDB14028PE(14:0/14:1(9Z))Show
YMDB14029PE(14:0/14:1(11Z))Show
YMDB14030PE(14:1(9Z)/15:0)Show
YMDB14031PE(14:1(11Z)/15:0)Show
YMDB14032PE(15:0/15:0)Show
YMDB14033PE(10:0/20:1(13Z))Show
YMDB14034PE(10:0/20:1(11Z))Show
YMDB14035PE(10:0/15:1(9Z))Show
YMDB14036PE(10:0/15:1(11Z))Show
YMDB14037PE(10:0/16:1(9Z))Show
YMDB14038PE(10:0/16:1(11Z))Show
YMDB14039PE(12:0/18:1(9Z))Show
YMDB14040PE(12:0/18:1(11Z))Show
YMDB14041PE(12:0/15:1(9Z))Show
YMDB14042PE(12:0/15:1(11Z))Show
YMDB14043PE(14:0/16:1(11Z))Show
YMDB14044PE(14:0/15:1(9Z))Show
YMDB14045PE(14:0/15:1(11Z))Show
YMDB14046PE(14:1(11Z)/16:0)Show
YMDB14047PE(15:0/15:1(9Z))Show
YMDB14048PE(15:0/15:1(11Z))Show
YMDB14049PE(12:0/16:1(11Z))Show
YMDB14050PE(14:1(9Z)/14:1(9Z))Show
YMDB14051PE(14:1(9Z)/14:1(11Z))Show
YMDB14052PE(14:1(11Z)/14:1(9Z))Show
YMDB14053PE(14:1(11Z)/14:1(11Z))Show
YMDB14054PE(14:1(9Z)/15:1(9Z))Show
YMDB14055PE(14:1(9Z)/15:1(11Z))Show
YMDB14056PE(14:1(11Z)/15:1(9Z))Show
YMDB14057PE(14:1(11Z)/15:1(11Z))Show
YMDB14058PE(14:1(9Z)/16:1(9Z))Show
YMDB14059PE(14:1(9Z)/16:1(11Z))Show
YMDB14060PE(14:1(11Z)/16:1(9Z))Show
YMDB14061PE(14:1(11Z)/16:1(11Z))Show
YMDB14062PE(15:1(9Z)/15:1(9Z))Show
YMDB14063PE(15:1(9Z)/15:1(11Z))Show
YMDB14064PE(15:1(11Z)/15:1(9Z))Show
YMDB14065PE(15:1(11Z)/15:1(11Z))Show
YMDB14066PE(15:1(9Z)/16:1(9Z))Show
YMDB14067PE(15:1(9Z)/16:1(11Z))Show
YMDB14068PE(15:1(11Z)/16:1(9Z))Show
YMDB14069PE(15:1(11Z)/16:1(11Z))Show
YMDB14070PE(14:0/16:0)Show
YMDB14071PE(15:0/16:1(9Z))Show
YMDB14072PE(15:0/16:1(11Z))Show
YMDB14073PE(15:1(9Z)/16:0)Show
YMDB14074PE(15:1(11Z)/16:0)Show
YMDB14075PE(14:1(9Z)/18:1(9Z))Show
YMDB14076PE(14:1(9Z)/18:1(11Z))Show
YMDB14077PE(14:1(11Z)/18:1(9Z))Show
YMDB14078PE(14:1(11Z)/18:1(11Z))Show
YMDB14079PE(16:1(9Z)/16:1(11Z))Show
YMDB14080PE(16:1(11Z)/16:1(9Z))Show
YMDB14081PE(16:1(11Z)/16:1(11Z))Show
YMDB14082PE(10:0/18:1(9Z))Show
YMDB14083PE(10:0/18:1(11Z))Show
YMDB14084PE(16:0/16:1(11Z))Show
YMDB14085PE(10:0/22:1(9Z))Show
YMDB14086PE(10:0/22:1(11Z))Show
YMDB14087PE(10:0/18:0)Show
YMDB14088PE(12:0/20:1(13Z))Show
YMDB14089PE(12:0/20:1(11Z))Show
YMDB14090PE(14:0/18:1(9Z))Show
YMDB14091PE(14:0/18:1(11Z))Show
YMDB14092PE(14:1(9Z)/18:0)Show
YMDB14093PE(14:1(11Z)/18:0)Show
YMDB14094PE(15:1(9Z)/18:1(9Z))Show
YMDB14095PE(15:1(9Z)/18:1(11Z))Show
YMDB14096PE(15:1(11Z)/18:1(9Z))Show
YMDB14097PE(15:1(11Z)/18:1(11Z))Show
YMDB14098PE(10:0/23:1(9Z))Show
YMDB14099PE(10:0/23:1(11Z))Show
YMDB14100PE(12:0/18:0)Show
YMDB14101PE(15:0/18:1(9Z))Show
YMDB14102PE(15:0/18:1(11Z))Show
YMDB14103PE(15:1(9Z)/18:0)Show
YMDB14104PE(15:1(11Z)/18:0)Show
YMDB14105PE(14:1(9Z)/20:1(13Z))Show
YMDB14106PE(14:1(9Z)/20:1(11Z))Show
YMDB14107PE(14:1(11Z)/20:1(13Z))Show
YMDB14108PE(14:1(11Z)/20:1(11Z))Show
YMDB14109PE(16:1(9Z)/18:1(11Z))Show
YMDB14110PE(16:1(11Z)/18:1(9Z))Show
YMDB14111PE(16:1(11Z)/18:1(11Z))Show
YMDB14112PE(10:0/24:1(9Z))Show
YMDB14113PE(10:0/24:1(11Z))Show
YMDB14114PE(12:0/22:1(9Z))Show
YMDB14115PE(12:0/22:1(11Z))Show
YMDB14116PE(14:0/20:1(13Z))Show
YMDB14117PE(14:0/20:1(11Z))Show
YMDB14118PE(14:0/18:0)Show
YMDB14119PE(14:1(9Z)/20:0)Show
YMDB14120PE(14:1(11Z)/20:0)Show
YMDB14121PE(16:0/18:1(11Z))Show
YMDB14122PE(16:1(9Z)/18:0)Show
YMDB14123PE(16:1(11Z)/18:0)Show
YMDB14124PE(15:1(9Z)/20:1(13Z))Show
YMDB14125PE(15:1(9Z)/20:1(11Z))Show
YMDB14126PE(15:1(11Z)/20:1(13Z))Show
YMDB14127PE(15:1(11Z)/20:1(11Z))Show
YMDB14128PE(10:0/25:1(9Z))Show
YMDB14129PE(10:0/25:1(11Z))Show
YMDB14130PE(10:0/20:0)Show
YMDB14131PE(12:0/23:1(9Z))Show
YMDB14132PE(12:0/23:1(11Z))Show
YMDB14133PE(15:0/20:1(13Z))Show
YMDB14134PE(15:0/20:1(11Z))Show
YMDB14135PE(15:0/16:0)Show
YMDB14136PE(15:1(9Z)/20:0)Show
YMDB14137PE(15:1(11Z)/20:0)Show
YMDB14138PE(16:0/18:0)Show
YMDB14139PE(14:1(9Z)/22:1(9Z))Show
YMDB14140PE(14:1(9Z)/22:1(11Z))Show
YMDB14141PE(14:1(11Z)/22:1(9Z))Show
YMDB14142PE(14:1(11Z)/22:1(11Z))Show
YMDB14143PE(16:1(9Z)/20:1(13Z))Show
YMDB14144PE(16:1(9Z)/20:1(11Z))Show
YMDB14145PE(16:1(11Z)/20:1(13Z))Show
YMDB14146PE(16:1(11Z)/20:1(11Z))Show
YMDB14147PE(18:1(9Z)/18:1(11Z))Show
YMDB14148PE(18:1(11Z)/18:1(9Z))Show
YMDB14149PE(18:1(11Z)/18:1(11Z))Show
YMDB14150PE(18:0/18:1(11Z))Show
YMDB14151PE(10:0/26:1(9Z))Show
YMDB14152PE(10:0/26:1(11Z))Show
YMDB14153PE(12:0/24:1(9Z))Show
YMDB14154PE(12:0/24:1(11Z))Show
YMDB14155PE(12:0/20:0)Show
YMDB14156PE(14:0/22:1(9Z))Show
YMDB14157PE(14:0/22:1(11Z))Show
YMDB14158PE(14:1(9Z)/22:0)Show
YMDB14159PE(14:1(11Z)/22:0)Show
YMDB14160PE(16:0/20:1(13Z))Show
YMDB14161PE(16:0/20:1(11Z))Show
YMDB14162PE(16:1(9Z)/20:0)Show
YMDB14163PE(16:1(11Z)/20:0)Show
YMDB14164PE(18:0/18:0)Show
YMDB15895PE(18:2(9Z,11Z)/18:2(9Z,11Z))Show
YMDB15896PE(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))Show
YMDB15899PE-NMe(18:2(9Z,11Z)/18:2(9Z,11Z))Show
YMDB15900PE-NMe(20:4(5Z,8Z,11Z,14Z)/20:4(5Z,8Z,11Z,14Z))Show
GO ClassificationNot Available
Gene Properties
Chromosome LocationNot Available
LocusYGR157W
Gene Sequence>2610 bp ATGTCCAGTTGTAAAACCACTTTGTCTGAAATGGTTGGTTCTGTGACAAAAGATAGGGGC ACTATCAACGTCGAAGCCAGAACACGTTCGAGTAATGTAACTTTCAAACCACCTGTAACC CACGATATGGTGCGTTCGCTTTTCGATCCAACTTTGAAGAAATCTCTGCTGGAAAAATGC ATCGCGCTAGCTATTATATCGAATTTTTTCATTTGTTATTGGGTCTTCCAAAGGTTTGGC TTACAGTTTACCAAATACTTTTTTCTGGTACAGTATTTATTTTGGAGAATTGCTTATAAT TTAGGTATTGGACTGGTTCTGCATTACCAGTCACATTATGAAACACTAACGAATTGTGCT AAAACTCATGCGATTTTCAGCAAAATACCACAGAATAAAGATGCTAATTCGAATTTCTCA ACAAATTCCAATTCCTTTTCAGAAAAATTTTGGAATTTTATTAGGAAGTTCTGTCAATAT GAGATTAGGTCTAAAATGCCAAAGGAGTATGATTTATTTGCCTATCCAGAAGAGATCAAC GTCTGGTTGATATTTCGCCAGTTTGTCGATTTAATCTTGATGCAAGATTTTGTGACTTAC ATTATTTACGTTTACCTTTCTATTCCATATAGCTGGGTTCAAATCTTCAACTGGAGATCT TTGCTAGGTGTTATTTTGATTTTATTTAACATCTGGGTCAAGTTAGATGCGCATCGCGTG GTTAAAGATTATGCTTGGTACTGGGGTGATTTCTTCTTTTTGGAAGAATCTGAATTGATT TTTGATGGTGTCTTCAACATCTCTCCACATCCAATGTATTCTATTGGTTATTTGGGTTAT TATGGCCTATCATTGATTTGTAATGACTACAAGGTTCTTCTGGTGTCCGTATTTGGACAT TATTCTCAATTTTTGTTTCTGAAATACGTCGAAAATCCTCATATTGAAAGAACGTATGGT GATGGCACTGATTCCGATTCTCAAATGAATAGCAGAATTGATGACTTGATATCAAAAGAG AATTACGATTATTCAAGACCTCTAATTAACATGGGTCTTTCTTTTAACAACTTCAATAAG CTAAGATTTACTGACTATTTCACAATTGGTACCGTAGCGGCACTTATGTTAGGAACAATC ATGAATGCTAGGTTTATCAATTTAAATTACCTCTTTATTACCGTTTTTGTAACAAAACTG GTTTCATGGTTATTTATCTCGACAATATTGTACAAGCAATCTCAGTCTAAATGGTTCACG AGATTGTTTTTGGAGAATGGTTACACACAAGTTTATTCCTATGAGCAATGGCAATTTATT TACAATTATTATTTGGTATTAACCTACACACTTATGATAATTCATACAGGGCTTCAAATT TGGAGTAATTTTTCCAACATAAACAACAGTCAATTAATTTTTGGTTTAATTCTTGTGGCT TTACAAACATGGTGTGATAAGGAAACGAGACTAGCAATCTCTGATTTTGGTTGGTTTTAT GGTGATTTTTTCTTGAGCAACTATATCTCAACTAGAAAGCTGACTTCCCAAGGTATCTAC AGATATTTGAATCACCCAGAAGCGGTATTAGGCGTTGTTGGAGTTTGGGGTACTGTATTG ATGACGAATTTTGCCGTTACAAATATTATCTTGGCTGTTTTATGGACATTGACAAATTTT ATTCTTGTCAAGTTTATTGAAACACCTCATGTTAATAAGATATATGGTAAAACTAAACGA GTTAGTGGTGTTGGAAAAACTTTACTAGGCTTGAAACCTCTAAGACAAGTTTCAGATATT GTCAATAGAATTGAAAATATTATAATCAAATCATTAGTTGATGAAAGCAAGAACTCCAAT GGTGGGGCAGAACTTTTGCCCAAAAATTATCAAGATAACAAAGAATGGAATATTTTAATT CAGGAAGCAATGGATAGCGTTGCAACAAGATTGAGTCCATACTGTGAATTGAAAATTGAA AACGAGCAGGTAGAAACCAATTTTGTCTTGCCTACTCCAGTAACTTTGAATTGGAAAATG CCCATTGAACTTTATAACGGAGATGATTGGATTGGTTTGTATAAAGTCATTGATACAAGG GCAGATCGTGAAAAAACAAGAGTTGGATCAGGTGGTCATTGGAGTGCGACTTCTAAAGAT TCATATATGAACCATGGATTAAGACATAAAGAATCTGTAACAGAAATAAAGGCGACTGAA AAGTACGTTCAAGGTAAAGTGACATTCGACACGTCTTTGCTTTATTTTGAAAATGGTATC TACGAATTTAGGTATCATTCTGGTAACTCCCATAAGGTGTTATTGATTTCTACACCATTT GAAATTTCATTGCCGGTACTAAATACCACGACACCTGAACTGTTTGAGAAGGATTTGACT GAGTTTTTGACGAAAGTCAACGTTTTGAAGGATGGTAAATTTCGTCCATTAGGAAATAAG TTCTTCGGGATGGACAGCTTGAAACAATTGATTAAGAACTCAATTGGCGTCGAACTTTCG TCTGAGTATATGAGGAGAGTCAATGGTGACGCTCACGTTATTTCGCATCGCGCTTGGGAT ATAAAACAAACGCTTGATAGTCTTGCTTGA
Protein Properties
Pfam Domain FunctionNot Available
Protein Residues869
Protein Molecular Weight101203.0
Protein Theoretical pI8.53
Signalling Regions
  • None
Transmembrane Regions
  • 60-80
  • 85-105
  • 179-199
  • 213-233
  • 245-265
  • 286-306
  • 366-386
  • 391-411
  • 439-459
  • 464-484
  • 496-516
  • 543-563
Protein Sequence>Phosphatidylethanolamine N-methyltransferase MSSCKTTLSEMVGSVTKDRGTINVEARTRSSNVTFKPPVTHDMVRSLFDPTLKKSLLEKC IALAIISNFFICYWVFQRFGLQFTKYFFLVQYLFWRIAYNLGIGLVLHYQSHYETLTNCA KTHAIFSKIPQNKDANSNFSTNSNSFSEKFWNFIRKFCQYEIRSKMPKEYDLFAYPEEIN VWLIFRQFVDLILMQDFVTYIIYVYLSIPYSWVQIFNWRSLLGVILILFNIWVKLDAHRV VKDYAWYWGDFFFLEESELIFDGVFNISPHPMYSIGYLGYYGLSLICNDYKVLLVSVFGH YSQFLFLKYVENPHIERTYGDGTDSDSQMNSRIDDLISKENYDYSRPLINMGLSFNNFNK LRFTDYFTIGTVAALMLGTIMNARFINLNYLFITVFVTKLVSWLFISTILYKQSQSKWFT RLFLENGYTQVYSYEQWQFIYNYYLVLTYTLMIIHTGLQIWSNFSNINNSQLIFGLILVA LQTWCDKETRLAISDFGWFYGDFFLSNYISTRKLTSQGIYRYLNHPEAVLGVVGVWGTVL MTNFAVTNIILAVLWTLTNFILVKFIETPHVNKIYGKTKRVSGVGKTLLGLKPLRQVSDI VNRIENIIIKSLVDESKNSNGGAELLPKNYQDNKEWNILIQEAMDSVATRLSPYCELKIE NEQVETNFVLPTPVTLNWKMPIELYNGDDWIGLYKVIDTRADREKTRVGSGGHWSATSKD SYMNHGLRHKESVTEIKATEKYVQGKVTFDTSLLYFENGIYEFRYHSGNSHKVLLISTPF EISLPVLNTTTPELFEKDLTEFLTKVNVLKDGKFRPLGNKFFGMDSLKQLIKNSIGVELS SEYMRRVNGDAHVISHRAWDIKQTLDSLA
References
External Links
ResourceLink
Saccharomyces Genome Database PEM1
Uniprot IDP05374
Uniprot NamePEM1_YEAST
GenBank Gene IDM16987
Genebank Protein ID172114
General Reference
  • Kodaki, T., Yamashita, S. (1987). "Yeast phosphatidylethanolamine methylation pathway. Cloning and characterization of two distinct methyltransferase genes." J Biol Chem 262:15428-15435.2445736
  • Skala, J., Nawrocki, A., Goffeau, A. (1995). "The sequence of a 27 kb segment on the right arm of chromosome VII from Saccharomyces cerevisiae reveals MOL1, NAT2, RPL30B, RSR1, CYS4, PEM1/CHO2, NSR1 genes and ten new open reading frames." Yeast 11:1421-1427.8585325
  • Tettelin, H., Agostoni Carbone, M. L., Albermann, K., Albers, M., Arroyo, J., Backes, U., Barreiros, T., Bertani, I., Bjourson, A. J., Bruckner, M., Bruschi, C. V., Carignani, G., Castagnoli, L., Cerdan, E., Clemente, M. L., Coblenz, A., Coglievina, M., Coissac, E., Defoor, E., Del Bino, S., Delius, H., Delneri, D., de Wergifosse, P., Dujon, B., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome VII." Nature 387:81-84.9169869
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Kim, H., Melen, K., Osterberg, M., von Heijne, G. (2006). "A global topology map of the Saccharomyces cerevisiae membrane proteome." Proc Natl Acad Sci U S A 103:11142-11147.16847258
  • Smolka, M. B., Albuquerque, C. P., Chen, S. H., Zhou, H. (2007). "Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases." Proc Natl Acad Sci U S A 104:10364-10369.17563356