You are using an unsupported browser. Please upgrade your browser to a newer version to get the best experience on Yeast Metabolome Database.
Identification
NameDelta-aminolevulinic acid dehydratase
Synonyms
  • ALADH
  • Porphobilinogen synthase
Gene NameHEM2
Enzyme Class
Biological Properties
General FunctionInvolved in porphobilinogen synthase activity
Specific FunctionCatalyzes an early step in the biosynthesis of tetrapyrroles. Binds two molecules of 5-aminolevulinate per subunit, each at a distinct site, and catalyzes their condensation to form porphobilinogen
Cellular LocationNot Available
SMPDB PathwaysNot Available
KEGG Pathways
Porphyrin and chlorophyll metabolismec00860 Map00860
SMPDB ReactionsNot Available
KEGG Reactions
5-Aminolevulinic acidwater + Porphobilinogen + hydron
Metabolites
YMDB IDNameView
YMDB000835-Aminolevulinic acidShow
YMDB00401PorphobilinogenShow
YMDB00862hydronShow
YMDB00890waterShow
GO Classification
Component
Not Available
Function
carbon-oxygen lyase activity
hydro-lyase activity
porphobilinogen synthase activity
catalytic activity
lyase activity
binding
ion binding
cation binding
metal ion binding
Process
metabolic process
biosynthetic process
cellular biosynthetic process
heterocycle biosynthetic process
tetrapyrrole biosynthetic process
Gene Properties
Chromosome Locationchromosome 7
LocusYGL040C
Gene Sequence>1029 bp ATGCATACAGCTGAATTTTTGGAAACAGAACCAACAGAAATCTCATCTGTTCTAGCAGGT GGTTATAATCACCCACTGCTGAGACAGTGGCAAAGTGAGCGTCAACTGACTAAGAACATG TTGATTTTTCCGCTATTCATCTCCGATAATCCAGATGACTTTACTGAAATTGACTCTCTA CCTAATATCAATAGAATCGGTGTAAATAGGCTAAAAGACTACTTAAAGCCATTAGTGGCC AAGGGTTTGCGTTCTGTGATCTTGTTTGGTGTGCCTCTCATCCCTGGTACCAAGGATCCA GTGGGTACAGCGGCTGACGATCCTGCAGGGCCAGTCATTCAAGGTATTAAATTCATTCGT GAGTATTTCCCTGAACTGTATATTATTTGCGATGTCTGTCTCTGTGAATACACTTCTCAT GGCCATTGCGGGGTTCTATACGATGATGGTACTATTAATAGAGAACGTAGTGTCTCTAGA TTAGCAGCTGTGGCAGTTAACTACGCTAAAGCTGGTGCGCACTGTGTGGCTCCCAGTGAT ATGATCGATGGTAGGATCAGAGATATTAAACGAGGCTTAATAAATGCAAACTTGGCTCAC AAGACCTTCGTGTTATCCTATGCAGCTAAGTTTAGCGGTAATCTATATGGGCCATTCCGT GATGCTGCTTGTTCAGCTCCTTCGAATGGTGATAGGAAATGTTACCAATTACCTCCTGCC GGTCGTGGCCTGGCACGTAGGGCGTTGGAAAGGGATATGAGTGAAGGTGCCGACGGTATT ATTGTTAAGCCTTCCACTTTCTACTTAGATATAATGAGGGATGCAAGTGAAATTTGTAAA GACTTACCAATCTGCGCATATCACGTGTCGGGCGAATACGCAATGTTACATGCTGCAGCT GAAAAAGGTGTTGTTGATTTGAAGACAATTGCCTTTGAATCTCATCAAGGTTTCTTGAGG GCGGGTGCCAGATTAATCATCACTTATTTGGCTCCTGAGTTCCTAGACTGGTTAGATGAA GAAAACTAA
Protein Properties
Pfam Domain Function
Protein Residues342
Protein Molecular Weight37739.69922
Protein Theoretical pI6.05
PDB Fileshow
Signalling Regions
  • None
Transmembrane Regions
  • None
Protein Sequence>Delta-aminolevulinic acid dehydratase MHTAEFLETEPTEISSVLAGGYNHPLLRQWQSERQLTKNMLIFPLFISDNPDDFTEIDSL PNINRIGVNRLKDYLKPLVAKGLRSVILFGVPLIPGTKDPVGTAADDPAGPVIQGIKFIR EYFPELYIICDVCLCEYTSHGHCGVLYDDGTINRERSVSRLAAVAVNYAKAGAHCVAPSD MIDGRIRDIKRGLINANLAHKTFVLSYAAKFSGNLYGPFRDAACSAPSNGDRKCYQLPPA GRGLARRALERDMSEGADGIIVKPSTFYLDIMRDASEICKDLPICAYHVSGEYAMLHAAA EKGVVDLKTIAFESHQGFLRAGARLIITYLAPEFLDWLDEEN
References
External Links
ResourceLink
Saccharomyces Genome Database HEM2
Uniprot IDP05373
Uniprot NameHEM2_YEAST
GenBank Gene IDAY692744
Genebank Protein ID51012939
PDB ID
1OHL
General Reference
  • Myers, A. M., Crivellone, M. D., Koerner, T. J., Tzagoloff, A. (1987). "Characterization of the yeast HEM2 gene and transcriptional regulation of COX5 and COR1 by heme." J Biol Chem 262:16822-16829.2445751
  • Tettelin, H., Agostoni Carbone, M. L., Albermann, K., Albers, M., Arroyo, J., Backes, U., Barreiros, T., Bertani, I., Bjourson, A. J., Bruckner, M., Bruschi, C. V., Carignani, G., Castagnoli, L., Cerdan, E., Clemente, M. L., Coblenz, A., Coglievina, M., Coissac, E., Defoor, E., Del Bino, S., Delius, H., Delneri, D., de Wergifosse, P., Dujon, B., Kleine, K., et, a. l. .. (1997). "The nucleotide sequence of Saccharomyces cerevisiae chromosome VII." Nature 387:81-84.9169869
  • Hu, Y., Rolfs, A., Bhullar, B., Murthy, T. V., Zhu, C., Berger, M. F., Camargo, A. A., Kelley, F., McCarron, S., Jepson, D., Richardson, A., Raphael, J., Moreira, D., Taycher, E., Zuo, D., Mohr, S., Kane, M. F., Williamson, J., Simpson, A., Bulyk, M. L., Harlow, E., Marsischky, G., Kolodner, R. D., LaBaer, J. (2007). "Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae." Genome Res 17:536-543.17322287
  • Feuermann, M., de Montigny, J., Potier, S., Souciet, J. L. (1997). "The characterization of two new clusters of duplicated genes suggests a 'Lego' organization of the yeast Saccharomyces cerevisiae chromosomes." Yeast 13:861-869.9234674
  • Ghaemmaghami, S., Huh, W. K., Bower, K., Howson, R. W., Belle, A., Dephoure, N., O'Shea, E. K., Weissman, J. S. (2003). "Global analysis of protein expression in yeast." Nature 425:737-741.14562106
  • Albuquerque, C. P., Smolka, M. B., Payne, S. H., Bafna, V., Eng, J., Zhou, H. (2008). "A multidimensional chromatography technology for in-depth phosphoproteome analysis." Mol Cell Proteomics 7:1389-1396.18407956
  • Erskine, P. T., Senior, N., Awan, S., Lambert, R., Lewis, G., Tickle, I. J., Sarwar, M., Spencer, P., Thomas, P., Warren, M. J., Shoolingin-Jordan, P. M., Wood, S. P., Cooper, J. B. (1997). "X-ray structure of 5-aminolaevulinate dehydratase, a hybrid aldolase." Nat Struct Biol 4:1025-1031.9406553
  • Erskine, P. T., Newbold, R., Roper, J., Coker, A., Warren, M. J., Shoolingin-Jordan, P. M., Wood, S. P., Cooper, J. B. (1999). "The Schiff base complex of yeast 5-aminolaevulinic acid dehydratase with laevulinic acid." Protein Sci 8:1250-1256.10386874
  • Erskine, P. T., Duke, E. M., Tickle, I. J., Senior, N. M., Warren, M. J., Cooper, J. B. (2000). "MAD analyses of yeast 5-aminolaevulinate dehydratase: their use in structure determination and in defining the metal-binding sites." Acta Crystallogr D Biol Crystallogr 56:421-430.10739915
  • Erskine, P. T., Coates, L., Newbold, R., Brindley, A. A., Stauffer, F., Wood, S. P., Warren, M. J., Cooper, J. B., Shoolingin-Jordan, P. M., Neier, R. (2001). "The X-ray structure of yeast 5-aminolaevulinic acid dehydratase complexed with two diacid inhibitors." FEBS Lett 503:196-200.11513881
  • Erskine, P. T., Newbold, R., Brindley, A. A., Wood, S. P., Shoolingin-Jordan, P. M., Warren, M. J., Cooper, J. B. (2001). "The x-ray structure of yeast 5-aminolaevulinic acid dehydratase complexed with substrate and three inhibitors." J Mol Biol 312:133-141.11545591